KEGG   Drosophila sechellia: Dsec_GM13871Help
Entry
Dsec_GM13871      CDS       T01064                                 

Definition
GM13871 gene product from transcript GM13871-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dse  Drosophila sechellia
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM13871
   00052 Galactose metabolism
    Dsec_GM13871
Enzymes [BR:dse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dsec_GM13871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 364 aa AA seqDB search
MVIVTEDVFANGEVNPFTKSKDTIKRFTLTNGAGMSVQLITRGATITSIKTPDASGQIDD
VTLGFDDLAGYQSERNPYFGATIGRVCNRIANGSFYLDGKLVEVSKNRDNKFQLHGGFVG
FDKAHWEVVEVSGDGVTLSHTNPDGHEGYPGKVTATASFTLSEDNCLHVQMSAVADKTTP
VNLTNHSYFNLAGHKSGANGLYEHTIEINAYGITETDQSSIPTGRITPVEGTGFDLRVSS
NLGERLKALQPARGYDDNFCVTFSPPQPLAKVARATHPPSGRWLEVVSNQPGVQFYTSNF
MPDVERGDSPIPGKDGAAYAKHGAFCLETQKFPDSVNHSNFPSTILRPGESYQHEVIYKF
GVSH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcgtcacggaggacgtattcgccaacggagaggtgaatccgttcaccaagtca
aaggacaccatcaagcggttcaccctgacaaacggagcaggaatgtccgtgcagttgatc
acccgtggagccaccattaccagcataaagacgcccgatgccagcggtcaaatagatgac
gtgaccctcggatttgatgatttggcgggctatcagagcgagaggaatccgtactttgga
gcaaccattgggcgggtttgcaaccggattgccaacggcagcttttatctggatggaaag
ctggtggaggtgtctaagaaccgggacaacaagtttcaactccatggcggctttgtgggc
ttcgataaggctcactgggaagttgtggaagtaagtggggatggtgttactctgtcccac
accaatcccgatggacacgaaggctatcccggcaaggtgacagccacggcaagctttact
ctcagcgaggataactgcctccatgtccagatgagtgcagtagcagataaaaccactccc
gtaaatctcaccaatcactcctatttcaacctagctggccacaaatctggagccaacggt
ctctacgagcacaccatcgagataaatgcttatgggattactgagacggaccagtcttcc
attcccacgggccggatcacacccgtggagggaacaggatttgatttacgtgtgtccagc
aatctgggagaacgcctcaaggcgctgcaaccagctcgcggctacgatgacaacttctgt
gtaaccttcagtccaccgcaaccattggccaaggtggccagagccactcatccgcccagc
ggacgctggctggaggtggtcagcaatcagcccggagtgcagttttacacctccaacttt
atgccggatgtggaacgcggtgattcgcccattcccggcaaggatggagctgcctatgcc
aagcatggtgccttctgcctggagacacagaagttccccgactccgtaaaccacagcaac
tttccctcgaccattttgcgacctggcgaaagttaccagcacgaagtcatctacaagttt
ggagtttctcactga

DBGET integrated database retrieval system