KEGG   Drosophila sechellia: Dsec_GM13909Help
Entry
Dsec_GM13909      CDS       T01064                                 

Definition
GM13909 gene product from transcript GM13909-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dse  Drosophila sechellia
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dse00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 524 aa AA seqDB search
MVKSCLILCFFALLVIQARSDLADDQEHAQHPRLQTSRDFEALDEELDTRFWHDKAQSIL
ADKLAGHRKLNDNRAKNVILFLGDGMSVHTITATRAFMGDSNKQVFFEKFPYLGLSKTYA
VNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGDCGTNSSSHVQSIGQWAQEAGKWAG
VVTTARVTHASPAGVYAHVAERNWEHDGEIISSKCSPDVNTDIARQLVEWPVGQELRVIM
GGGRSYFRDQSQHDETGVSGLRTDGRDLISDWREIKKQQGAEGKYVWSLKGLKETDLSKT
DYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEEGYFLFVESGRIDMA
HHATKAKKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYRRQNILSLA
PNLADDELPFTVLSYANGPGFADTYSTKDGRIDLSHADTTSAEFEFQATVPLSSETHGAE
DVGVFASGPFEHLFTGNYEQSSIPAMMAYAANIGPFAKDKINEE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagagttgcctgatcttgtgcttcttcgctctcctggtcatccaggcccggagt
gatctagccgatgaccaagagcacgcccaacatccccgtctgcaaacatcacgcgacttc
gaggccctcgacgaggagctggacacacgattctggcacgataaggcccaatcgattctc
gccgataagctggccggccataggaaactcaacgataatcgcgccaagaacgtgatccta
tttttgggcgatggcatgtccgtccacacgatcacggccacacgtgcattcatgggcgat
agcaacaagcaggtcttcttcgagaagttcccctacttgggtctgtccaagacgtatgcc
gtcaatgagcgtactccggactcggccaacactgctacggcctatttgaccggagtcaag
gccaactatggcaccattggagtcaatgcacaggtgcagaggggcgactgtgggaccaat
tcgagtagccatgtccagagcattggtcagtgggcccaggaggccggtaagtgggccgga
gtggttaccaccgcccgggtgacccacgcttctccagccggagtttatgcccatgttgcg
gagcgaaattgggagcacgatggtgagatcatcagctcaaaatgcagtcccgacgtcaac
accgatattgcccggcagctggtggaatggccagtgggtcaggaactgcgcgtcatcatg
ggcggcggtcgatcctatttccgggatcagtcccagcacgatgagactggcgtttcgggg
ctgcgaaccgatggacgcgatctgatcagcgattggcgagagatcaagaaacagcaggga
gcagagggcaagtacgtctggtcacttaagggcctgaaggaaacggatctcagcaagacg
gattaccttctcggcctcttcgacacctcccacctgccctaccatggcgatcgtcgacga
acccattatgaagatgcagagccatccctttccgacatgacagaggctgccatcaagatg
ctcagcaagaacgaggagggttacttcctgttcgtggagagtggacgcatcgatatggcc
catcacgccaccaaggcgaagaaggctttggaggacaccgaagaattcgcggcagccgtg
gaactggctaggaaaatgaccgacgaggaggacacgctgattgtggtgacttcggatcac
tcgcacaccatgtccatcaacggctatccgtaccgtcgacagaacatcctttcccttgct
cccaatctggctgatgatgagctgccctttaccgtcttgtcctatgccaatggtccggga
tttgctgatacctacagcactaaagatggacgcattgatctttcccatgcggacaccacg
agcgcggagtttgagttccaggccacggttcccttgagcagcgaaacccatggcgccgag
gatgtaggtgtctttgcatctggtcccttcgagcacctgttcaccggcaattacgagcag
agttccattccagccatgatggcttatgccgccaacattggaccatttgccaaggacaag
attaatgaggaataa

DBGET integrated database retrieval system