KEGG   Drosophila sechellia: Dsec_GM13946Help
Entry
Dsec_GM13946      CDS       T01064                                 

Definition
GM13946 gene product from transcript GM13946-RA
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
dse  Drosophila sechellia
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dsec_GM13946
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    Dsec_GM13946
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsec_GM13946
  Exosomal proteins of colorectal cancer cells
   Dsec_GM13946
  Exosomal proteins of bladder cancer cells
   Dsec_GM13946
Heparan sulfate/heparin binding proteins [BR:dse00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  Dsec_GM13946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1036 aa AA seqDB search
MNWTRVLLIGLTALALTFVEVASLSLDPVASAELEQFIRKGDVVISTRHIRPRRKLHISI
EALFMIDFPMLKHKMSFFLDRKQQRVTLDISANGATESRNFEIPNINETSTIRSLALQFS
KNRITLHVDCKASTHLDIDMNLAKLYTQMDDPVIKLKGNHRRGNLRMLRNKITEREKNKK
RDVRGWYEPTIAREGVVDHRHQEVPTDVERGDIPVLNGDCEEAFARSLSDLLALVKLLRE
DVAHQRQEIAYLRMLLENCAGCKNPSTTDNQLRIEPDCRSSNPCYPGVECLDSAAGPRCG
HCPLGFIGDGKSCKPGVTCAHHMCYPGVQCHDTVNGAQCDSCPAGYEGDGRTCSLRNPCL
DTPCPSGAQCLQVGDPPYFQCISCPMGHEVNGTSCRDMNECLLYDPCDELATCTNLSPGF
QCSPCPVGFNGTHAHGYFADYYSVEYRRQTCLDVDECRTGFFRCPEHSTCINEIGSYRCQ
CHEGYVTNGTYSCLDRSSVSMCPDGTVCDRNAVCLRMDNIRHKCHCNVGWAGNGLICGRD
TDVDGWPDQAIGCPELHCQRDNCPKLPNSGQEDADLDGHGDGCDDDADGDNVQNSQDNCW
LAYNTEQLDSDGDKVGDVCDNCVLKYNPRQLDTDEDGLGDECDGDIDNDSIPNALDNCPL
LPNPSQSDVDNDGVGDACDNCPNLPNPDQKDRDMDFVGDACHRDIDGDDDGVPNSLDNCP
MVSNSDQLDTDGDGTGDECDDDMDGDGIPNYKDNCPLAKNPKQEDFNRNGKGDSCEDDED
VDGVPNAMDNCPNNSMIHHTDFRTLQTIPLDPKGLSQADPNWVVHANGTEIVQTLNSDPG
LAVGKDAFGGVDFDGTFYINDDTDDDYAGFVFSYQSSYKYYVVQWKKGTQTYWEPRPFTA
SAAPGIQIKLVNSTEGPGPMMRNSLWHEGNTDGEARLLWKDPKNIAWKERTSYRWSLVHR
PAIGLIRLQMHEGNRLIFDSGNVFDSTLKGGRLGVFCFSQRMIIWSNLQYKCNNRVKPLI
YNDLSDYLKTKVELQD
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgaattggacgcgcgtgctgctaatcgggttgaccgccttggcgctgacatttgtggag
gttgcatcactctcactcgatccagttgcttccgctgaactggagcagtttatacgcaaa
ggagatgtggtcatatcaacgcgacacattagaccgcgtcgaaagttgcacatatccata
gaagcactcttcatgatcgacttccccatgctgaagcacaagatgtccttcttcctggac
cgcaaacagcagcgggtaacgctggacatcagtgcgaatggagctaccgagtcgcgcaac
ttcgagatacccaacatcaacgagacgagcaccatccgatccctggcgctgcagttctct
aagaatcgcataacgctccatgtggactgcaaggcgagcacacatctcgacatcgacatg
aacctggccaagctgtacacccagatggacgatccggtgatcaagctgaaaggcaaccat
cgtcgtggcaatcttcgcatgctgcgcaacaagatcaccgagcgtgagaagaacaagaag
cgcgatgtgcgcggctggtatgagccaacgatcgcccgggaaggagtcgtggatcacaga
caccaggaggtgccaacggacgtggagcgcggcgacattcccgttctgaatggcgattgc
gaagaggccttcgcacgctcgctcagcgatttactggctctggtgaagctgctccgcgaa
gacgtcgcccaccagcgccaggagattgcctacctgcgtatgctcctggagaactgtgcc
ggctgcaagaatccctccaccaccgacaaccaactgcgcatcgagcccgactgccgttcc
tccaatccctgttatcctggagtggagtgcctggactcggcggccggtcctcgatgtggc
cactgtccccttggcttcattggcgatggcaagagctgcaagccgggcgttacctgcgcc
catcacatgtgctatccaggcgttcagtgtcacgataccgtgaatggagcccagtgtgac
tcctgtccagccggctacgaaggtgatggacgcacatgttcgctacgtaatccttgcctg
gacacaccgtgcccctcaggcgcccagtgcctccaggttggcgatccgccctactttcaa
tgtatctcgtgtccaatgggccacgaggtaaacggaaccagctgccgggatatgaatgag
tgcctgctctacgacccttgcgacgagctggcgacgtgcaccaatcttagtcctggcttc
cagtgcagcccgtgtcccgtcggcttcaacggcacccacgcccatggctacttcgccgac
tactactccgtggaatatcgcaggcaaacgtgcctggacgtcgatgagtgccgcactggc
ttcttccgatgcccagagcattccacctgcattaacgagattggttcctacagatgccag
tgccacgaaggatatgtaacaaatggcacctacagctgcctagacagatcctcggtgtcc
atgtgtccggatggaaccgtgtgtgaccgcaatgccgtgtgtcttaggatggataacatc
cgccacaagtgtcactgcaatgtgggatgggcgggcaacggattgatttgcggtagggat
accgacgtagatggatggccagatcaagcaatcggctgtccagagctgcactgtcagcgg
gacaactgcccgaagttgcccaattcgggccaggaggacgccgatctggatggacatggc
gatgggtgcgacgacgacgccgatggcgacaatgtccagaacagccaggataattgctgg
ctagcctacaacaccgagcagctggactccgatggagacaaggtgggcgatgtgtgcgac
aactgcgtgctcaagtacaatcccaggcagctggacacggacgaggatggactgggggac
gagtgcgatggggatatcgacaacgactccataccgaatgcgctggacaactgtccgctg
ctgccgaatcccagtcagtcggacgtggacaacgatggtgtgggcgacgcttgcgataac
tgtccgaatctcccgaatcccgaccagaaggatcgcgacatggactttgtaggcgatgcc
tgtcacagggacatcgatggggatgatgatggagttccaaactcgctggacaactgccca
atggtcagtaactcggaccagctggacactgacggtgatggaacaggcgatgagtgcgat
gacgacatggacggagacgggattcccaactacaaggacaactgtccgctggccaagaac
ccgaagcaggaggacttcaatcgcaatggcaagggtgactcttgcgaagatgatgaggac
gtagatggagtgccgaatgccatggacaactgcccgaacaactcgatgattcaccacact
gacttccgcactcttcaaaccattccactggatcccaaaggcctatcccaagcggatcca
aattgggtggtgcacgccaatggcaccgagatagtccagaccctcaactcggatcccggt
ttagcggtgggcaaggacgcattcggaggcgttgacttcgacggcaccttctacatcaac
gatgacacggacgatgactacgctggctttgtgttcagctaccagagcagctacaagtac
tatgtggtgcagtggaagaagggtacccaaacctactgggagccacgaccgttcaccgcc
tccgcagcgccgggcatccagattaagctggtcaacagcaccgagggtccggggccaatg
atgaggaacagcctgtggcacgaggggaacaccgacggcgaggctaggctgttgtggaag
gatccgaagaacattgcgtggaaggaaaggacctcctaccgctggtccctggtgcatcga
ccggccatcggcctcatccgcctgcaaatgcacgagggcaaccgcctgatcttcgactcg
ggcaatgtgttcgactccacgctgaagggcggtcggctgggcgtgttctgcttctcgcag
aggatgattatatggtccaacctgcagtacaagtgcaataatcgtgtgaagccgctgatc
tacaatgatctgtccgactatctcaagacgaaggtggagttgcaggactga

DBGET integrated database retrieval system