KEGG   Drosophila sechellia: Dsec_GM14114Help
Entry
Dsec_GM14114      CDS       T01064                                 

Definition
GM14114 gene product from transcript GM14114-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsec_GM14114
Transcription machinery [BR:dse03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dsec_GM14114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1046 aa AA seqDB search
MRVPLLPLQLLGLLLLLAGGVQSVYCPAGCTCLERTVRCIRAKLSAVPKLPQNTQTLYLN
NNRISRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPHLNRLIMYNNKLTQLPVDGF
NRLNNLRRLRLDGNAIDCNCGVYSLWRRWHLDVQRQLVSISLTCAAPQPLQNQSFSSLGE
HHFKCAKPQFLVAPQDAQVAAGEQLELSCEVTGLPRPQITWMHNTQEVGLEKQAQAEIQP
SGSLLIRSADTSDMGIYQCIARNEMGELRSQPVRLVVNGGNHPLDSPIDARSNQVWADAG
TPTHGATPVPSPSPPHFTHQPHDQIVALHGSGTRAARLRRLRLATAGHTMVRQWPPTPAV
DPQPPTAGQWHYLNFPILAKGFVRQDSVHDFVNSDSDGDFIALSGSKSEVITLELSSKFM
VVDPFPYFVAIYDSNAAETRPLDVLANKVDLVSIYDSCDVLEAQHLALDPAYTAVCSVAV
PPSRLRAVKRAPKQVANGNLLLGSLNTYGSLSLINKSAEYNRWNPLEGLNIAETLRDTLL
PEVDIGKIKDFKSYQEYINPAWITMFAWLPDNADTTGQHVLVLGTASGSLWLLTLSADAK
TLLSHQETKTSMGRICHIQAFKDLLLVGDSNGLIHLYQLPAKGNTALVLVKPLWEKADRM
GLQMAVITECPRTDCYYITCCKAAHLLTWSMPRTGNTDCLQARIYVGGMKITALCSLDNT
SYAAGTAGSCLHCVQIIHENNQLSLQTQSIAMSVLQDFQVMGLCTSRHKNLMTLFLYRNK
EYLNETVSQKNQLVMQVLKVGNQDPLEQLIRHLKSNKPMNHYTDLLAALRLHVFAEENWQ
KYMDFGPLDSFEFADSATEGQLQQLQIKFHVLQNAIRLQSSHLQLTVHIQKSRDELQLLL
AMLNITHIRLRLQFIGSLSKRSPFQEQAIQCMFEEAHRLINKLKADFTENHVQGSTAKEF
VEKMDNHIQHLHEMLGIPVISNSQKQLHRCSVSFVEISLSLDRRYCSLCDRQVIFELDNL
RELYESGRNLACPVCHGSFATEMFDA
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgcgagttccgctgctcccgctgcagctgctcggcctgctgctcctcctcgccggcgga
gtgcagtccgtctactgtccggccggatgcacctgcctggagcgaacagtgcgctgcatc
cgcgccaagctgtccgccgtgcccaaactgccccagaatacccaaacgctctatctgaac
aataatcggataagccgcttaccggcgaccatcttccagcggatgccgcgcctggaggcg
attttcctggaaaacaatgacatatggcagctgcccgccgggctctttgacaacttgccg
catctgaaccgcctgatcatgtacaacaacaagctgacccaactgccagtggacggattt
aatcggctgaacaacctgaggcgcctgcgactggacggcaacgccatcgactgcaattgt
ggcgtttactcgctgtggcgtcgctggcacctggatgtccagcgccagttggtgtccatc
tcgctcacctgtgccgctccccagccacttcaaaaccagagcttttccagcctgggcgag
catcacttcaaatgcgccaagccgcagttcctggtggcaccccaagacgcccaagtcgct
gccggggagcagctggagctgagctgcgaggtcaccggcctgccccgcccccagatcacg
tggatgcacaacacgcaggaggtgggcctggagaagcaggcgcaggcggagatccagccc
agcggcagcctgctcatccgcagcgcggacaccagcgacatgggcatctaccagtgcatc
gctcgcaacgagatgggcgagctgcgttcccagcccgttcgcctggtagttaatggcggt
aaccacccactcgattcgcccatcgacgcccgcagcaatcaggtgtgggcggatgccgga
acacccacacacggagcaacgccagttccatctccatcgccaccgcactttacccaccag
ccgcacgaccaaattgtggcccttcacggctctgggacacgtgctgctcgattgcgccgc
ctccggctggccacagccggacatacaatggttcgtcaatggccgccaactcctgcagtc
gacccccagcctccaactgcaggccaatggcattatctgaattttcctatcctagccaaa
ggattcgtccgccaggactcggtacacgactttgtaaacagcgattccgatggagacttt
atagcactgagcggatccaaatcggaagtgatcaccctggagttgagcagcaagttcatg
gtcgtggatccctttccctattttgtggccatttatgattccaacgctgcggaaacacga
cccctggacgttttggccaacaaagtggatctggtgtccatatacgacagctgcgatgtc
ctggaggcacagcacttggccctggacccggcatacacggctgtgtgctccgttgccgtg
ccaccatccagattaagagctgttaagagggcacccaagcaggtagctaatggaaatctc
ctcctgggctccctcaacacctatggatccttgagcctgataaacaagtctgcagagtac
aatcgttggaaccccctggaaggactaaatatcgctgaaactctgagggacactctgctg
cctgaagtggacatcggcaagattaaagactttaaaagctatcaagaatatattaacccc
gcgtggatcactatgtttgcttggttacctgataatgcagataccactggccagcatgtt
ttggtgctgggaaccgcttccggaagtttgtggttgctcacactaagcgccgatgccaaa
actcttttgagtcatcaagaaacgaaaacctcaatgggtcgtatctgccatatacaagct
ttcaaggaccttctactggtgggcgatagcaacggcctcatccacctgtaccaattgcca
gcaaagggaaatacagctctcgtcttagtgaagcccttgtgggagaaagccgatcgcatg
ggtctgcaaatggcagtgatcactgaatgtcccagaacggattgctattatataacctgt
tgcaaggcggcgcacctgctgacctggagcatgccaagaacgggaaacacagactgcctg
caagcacggatctatgtcggcggaatgaagatcaccgctctctgcagcctggacaacact
agctatgctgcaggaaccgctggaagctgtctgcattgcgtacaaattatccacgagaat
aatcagcttagcctgcagacgcaatcgatagccatgagtgttctccaggatttccaggta
atggggctgtgcaccagtaggcacaaaaacttaatgaccctgtttctataccgcaacaag
gaatatctgaatgagactgtgtctcaaaagaaccagttggttatgcaggtgctcaaggtg
gggaatcaggatccacttgaacagcttatcaggcatctgaaatccaataagcccatgaat
cactataccgatttattagctgcactacgtctgcacgtttttgccgaggagaattggcaa
aaatatatggattttggtccattagattcctttgaatttgcggattccgccactgagggt
cagctgcagcagctgcaaatcaaatttcatgtccttcagaacgcgattcgcctgcaatcg
agccacctccagctgactgttcacatccaaaagtcgcgggatgaactgcagctgctcctt
gcgatgctgaatatcacacacataagactgaggctccagttcattgggtcattgagtaag
agatcaccattccaggagcaggcgatacagtgtatgttcgaggaggcccaccgactgata
aataaacttaaggccgactttacggaaaatcatgtccaaggatccacagcaaaggaattc
gttgagaaaatggacaaccatattcagcacttgcacgagatgctgggtatacctgtgata
tctaattcccagaagcaacttcatcgatgcagtgtgtcctttgtggagatctccctcagc
ttggaccgacgctactgcagcctctgcgaccgccaggtcattttcgagctggacaatctg
cgagagctctacgagtctgggagaaatctggcatgtcccgtttgccatggaagctttgcc
acggaaatgtttgatgcataa

DBGET integrated database retrieval system