KEGG   Drosophila sechellia: Dsec_GM14565Help
Entry
Dsec_GM14565      CDS       T01064                                 

Definition
GM14565 gene product from transcript GM14565-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dse  Drosophila sechellia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dse00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dse00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 253 aa AA seqDB search
MAGRSIVHFFLGSVAIALGSYIYFTMQALRCYSMRRTLGPVLELSRGQRQCLRLCTVLLP
VSCAATPTYATSSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDISLEKYKGKVV
LVVNIASKCGLTKNNYQKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDS
KADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTT
DPMDIAKDIEKLL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccggccgctccatcgtccacttttttctggggtccgtggcaatcgccctgggatcg
tacatctacttcaccatgcaagccctcaggtgctactcgatgaggcggaccctgggcccc
gtcctcgagctgagtcgcggtcagaggcagtgccttcgcctctgcaccgtcctgcttccc
gtgagctgtgcggccacgcccacatacgccacctcctcagccgcccaacactccacagca
gctgccatcgacatgtctgctaacggagattacaagaacgccgcctcgatctacgagttc
accgtgaaggacacccatggcaacgatatttcgctggaaaagtacaagggcaaggtggtc
ctggtggtgaacatcgcctccaagtgcggcctgaccaagaacaactaccagaagctgacg
gatctgaaggagaagtacggcgagcgcggcctggtgatcctcaacttcccgtgcaatcag
tttggatcccagatgccggaggccgatggagaggccatggtgtgccacctgcgcgactcc
aaggctgacataggcgaggtgttcgccaaggtcgatgtgaatggagataatgcggcgccg
ctgtacaaatacctgaaggccaagcagaccggcaccctgggcagcggaatcaagtggaac
ttcaccaagttcctggtgaacaaggagggcgtgcccattaaccgatatgccccgaccacc
gatcccatggacatcgccaaggacattgagaagctgctgtag

DBGET integrated database retrieval system