KEGG   Drosophila sechellia: Dsec_GM14673Help
Entry
Dsec_GM14673      CDS       T01064                                 

Definition
GM14673 gene product from transcript GM14673-RA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dse  Drosophila sechellia
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dsec_GM14673
Enzymes [BR:dse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dsec_GM14673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 521 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRTYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASN
TNSNNNSNNKSDNDAGATANAGSGSGSGSGAGAKGAKENNI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgcacagcaaaaagcgcgtttgttactactacgatagcgacattggcaactac
tactatggccagggtcatcccatgaagccgcaccgcatacgcatgacccacaacctgctg
ctcaactatgggctctatcgaaaaatggaaatataccgtccccataaagccactgccgat
gagatgaccaagttccactcggacgagtacgtccggttcctgcgatccattcggccagac
aacatgtcggagtacaacaagcagatgcagcgattcaatgtcggcgaagattgtcccgtc
ttcgatggactgtacgagttttgccaactgtccgccggaggatccgtagcggcggccgta
aaactgaataagcaagcctcggagatctgcatcaattggggcggtggactgcatcacgct
aagaaatcggaggcctcgggcttctgctacgtcaacgacattgtcctgggaattctggag
ctgcttaaataccaccagcgtgttctctacatagacatagacgtccatcacggcgatggc
gtggaggaggcgttctataccaccgatcgtgtgatgactgtcagcttccacaagtacgga
gagtatttcccgggcaccggcgatctgcgagacattggcgccggaaaggggaagtactat
gcggtgaatatacccctgcgtgatggcatggatgatgacgcgtacgagagcatatttgtg
cccattatcagcaaggtgatggaaacattccagccggcagccgtggtgctgcagtgtggc
gccgattcgctgactggcgatcggttaggttgcttcaatctcaccgtcaagggtcacggc
aaatgcgtggagttcgtgaagaagtataacctgccattcctgatggtcggcggtggtggt
tataccattcgtaacgtatcccgctgctggacctatgagacctccgtggcactggccgtg
gagatagccaacgaactgccctacaacgattacttcgagtactttggacccgatttcaag
ctgcacataagccccagcaatatgacgaatcagaatacatccgagtacctggagaagatc
aagaaccgtctgtttgagaacctgcgcatgctgcctcacgctccgggcgtgcaaatccaa
gcgattcccgaggatgccatcaacgatgagtccgacgacgaggacaaggtcgacaaggac
gatcgcctgccgcagagcgacaaggacaagcgcattgtgcccgagaacgagtactccgat
tcggaggatgagggcgagggcggtcgcagggataaccggacgtacaagggtcagcggaag
cggccgcgtcttgacaaggacaccaacagcaacaaggcgtcctcagagacgtccagcgaa
atcaaggacgaaaaggaaaagggcgacggagctgatggcgaggagtcgacggcgtccaat
acgaatagcaacaacaacagtaacaacaagagcgataatgacgccggagcgacagctaat
gccggatccggatcgggatcaggttccggtgccggggccaagggcgccaaggagaacaac
atttga

DBGET integrated database retrieval system