KEGG   Drosophila sechellia: Dsec_GM14932Help
Entry
Dsec_GM14932      CDS       T01064                                 

Definition
GM14932 gene product from transcript GM14932-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsec_GM14932
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsec_GM14932
Transcription machinery [BR:dse03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dsec_GM14932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 192 aa AA seqDB search
MLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAK
IKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSE
KKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGY
LLFYHKNVLEYE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagagcgatgtggtgtgccaggcgtgcaacggagtgtccaccacgtacgatccg
ttttgggacatatcgctggacctgggcgaaacaacaacgcatggtggtgttaccccaaaa
acgctgatagactgcctggagcggtacactcgggccgagcatctcggatcggccgccaaa
atcaagtgttctacctgcaaatcctaccaggagtccaccaaacagttcagcttgcggacg
ctgcccagcgtggtgtccttccatctgaaacgcttcgagcactcagctctgatcgatcgc
aagatctcctcgttcatccagttccccgtggagttcgacatgacgccctttatgtcggag
aagaagaacgcctacggagacttccggttctctctgtacgccgtggtcaatcatgtgggc
accatcgacaccggtcactatacggcgtatgtgcggcaccagaaggacacgtgggtcaag
tgcgatgatcatgtgataacgatggcatcgctcaagcaggtgctggacagcgagggttat
ttattgttttaccataaaaacgtgctggaatacgagtaa

DBGET integrated database retrieval system