KEGG   Drosophila sechellia: Dsec_GM15069Help
Entry
Dsec_GM15069      CDS       T01064                                 

Definition
GM15069 gene product from transcript GM15069-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
dse  Drosophila sechellia
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dse04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 896 aa AA seqDB search
MAKLKKLHMSSNLDDLEKMSIIPDLRSKGMKILLNTARKLYMTAEEYRLDGDEELAYITY
MKYFNMLTAIHQKSDYASHKTTVRQMLGDTESNRRIMDTLEKIIHSLRHRYAQQHQAPEP
IAPDLVSNGRAGVDSPITQPTQYARLGLITCQDLYRRMQEKSVLVMDCRPSADYEASHLT
YYCAFNVPEELITPGMSAGRLQARLSSSAKASWASRSVKDSVVLMDWNTKDAQPATNTAI
STLLDILKNWDPDVTYRAPIQIVEGGYEYFIMMYPTHCTNPSVQAPQQNNNDIETIDDIE
YPSIHDITMKEDISAKDFRPRPDFNRANKPAATRVNEQGISRPSPPAKPIAEIMRDQAEF
LQRAEQNDEQLERASKMWKRQAAEGDGLNATEDQELHFRILQLESKAQDYIVENNRLREE
LSRIQELHNVTQQLSQKEVEATRNIESKIRERQRLDEQHELERQERERLLAIARETKKHY
KSPTASGPPSPGRNLEDVHVVSDSLESLLQLTGDPDPTIASNKAERPTFDRAMKPQPRNV
ERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYI
SRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTIL
MDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESA
TYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHGWNCPSCKTKRDAIKKLDISKLPPV
LVVHLKRFYADPSNSGAYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHY
GTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFYTWLPPMQVPL
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggccaagttgaagaagctgcacatgagctcgaaccttgatgacctggagaagatgtcc
atcattccagatctgcgcagcaagggcatgaaaatcctgctgaacaccgcccgcaaactg
tacatgaccgccgaggagtacagactggatggcgacgaggaactggcctacatcacctac
atgaagtacttcaatatgctgaccgcgattcaccaaaaatccgattacgccagccacaaa
acgacggtgcgccagatgctgggcgacaccgagtcgaatcgacgcattatggacacgctg
gagaagattatacactctctgcggcatcgttatgctcagcagcatcaggcgccggaacca
atcgctcccgacctggtcagcaatgggcgtgcgggtgtggactcgccgataacacagcca
acgcagtacgccagacttgggctgatcacctgtcaggatctgtatcggcgcatgcaggag
aaatcggtcctagttatggactgtcgcccaagcgccgactacgaggcctcccacctcacg
tactactgtgcatttaacgtgcccgaggagttgataacgccaggaatgtcggctggcaga
ttgcaggctcgtcttagcagcagcgccaaggcgtcgtgggcatcgcgttccgtcaaggat
tcggtggttcttatggactggaacaccaaggatgcccaaccggcgaccaacacagccatt
tcaaccctgctcgacatcctcaagaactgggatccggatgtgacgtatcgcgcacccatt
caaattgtcgagggcggttatgagtacttcattatgatgtacccgacccactgcaccaat
cccagtgtgcaggctccgcagcagaacaacaacgacattgagaccatcgatgacatcgag
tatccttcaattcacgacatcaccatgaaagaggatattagtgcgaaggacttcagacca
cgtccagacttcaatagggccaacaagccagcggccactcgcgttaatgaacagggaatt
tcccgtccttctccgccggctaagcccatcgctgagatcatgcgtgatcaggccgagttt
ttgcagcgcgcagagcagaacgatgagcagttggagagggcctcaaaaatgtggaagcgt
caagcagcagagggcgatggtttgaatgctaccgaggaccaagagttgcacttcaggatc
ctacagttggagagcaaggcccaggactatatcgtggaaaacaatcgtctgcgagaagaa
ctaagtcgcatacaagagctacacaatgtaacgcagcagttgtcacaaaaggaggtcgag
gcaacgaggaatatagaatccaagatccgcgaacgacagcgcttggacgagcagcatgaa
cttgaacgtcaggagcgggagcgccttttggcgatcgctcgcgagacaaaaaagcattac
aagtcaccaacagcttcgggaccgccttcgccgggcaggaacttggaggacgtacatgtc
gtgtcagacagcctggagtccctgctccagctaactggcgatccggatcctacaattgcg
tcaaacaaggcggaaagacctacattcgatcgggcgatgaaaccgcagccgaggaacgtg
gagaggacatcgcaacgcgttcgtgatttctcgcctgtcattggtcagaatgtgggtcgt
ggactgactggtttgaagaatctgggcaacacctgctatatgaacagcatactgcagtgc
ctgagcaacacgcctcagttgaccgagtactgcatttcggacaaatacaagaattacatc
agcagaagcaacaagaccaatggccaggtgatcgaggaggtggctgcactcatcaaggag
ctctggaatggacagtacaagtgtgtggccagccgagacttgaggtacgttgtgggccag
tatcagaagatcttccgcggcgttgaccagcaggactcacacgaattcctcaccatcctg
atggactggctgcactcggatctgcagaccctacacgtgccccgtcagcgtgagatgatc
agtgcgtcggagaaggcttggctggaatttaccaaggcgaaggagagcatgattctgcat
ttattctatggccaaatgaagagcactgtgaagtgtgtggcctgccacaaagaatcggcc
acgtacgagagcttctctaatctcagcctggagctgccgcccaactcgaatgtctgccag
ctaaaccagtgcatggacatgtacttcagtggagaacggatccatggctggaattgtcct
agttgtaaaaccaaaagagatgccattaagaagctggatatatcgaagctgccacctgtg
ctggtggtgcacctgaagcggttctatgcggatcccagtaactccggggcgtacatgaag
aagcagaactacctgcgtttcccgctggagaacttggacatgaatccctacatagcacgg
gcggaatcgcgggcggtaacccccaagacctaccagctgtacgccgtttccaatcactac
ggcaccatggaaggcggccactacacggccttttgcaagagcgccaactacggaaagtgg
ttcaagttcgacgatcaggtcgtctcggcgttggactcctcgaacgtggtttctagcgct
gcgtacattctcttctacacctggctgccacccatgcaggtgccgctgtag

DBGET integrated database retrieval system