KEGG   Drosophila sechellia: Dsec_GM15163Help
Entry
Dsec_GM15163      CDS       T01064                                 

Definition
GM15163 gene product from transcript GM15163-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dse  Drosophila sechellia
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsec_GM15163
   00670 One carbon pool by folate
    Dsec_GM15163
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dsec_GM15163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 182 aa AA seqDB search
MLRFNLIVAVCENFGIGIKGDLPWRIKSELKYFSRTTKRTSDPTKHNAVVMGRKTYFGVP
ESKRPLPDRLNIVLSTTLQESDLPKGVLLCPNLETAMKILQEQNEVENIWIVGGSGVYEE
AMASPRCHRLYITKIMQKFDCDTFFPAIPDSFREVAPDSDMPLGVQEENGIKFEYKVLEK
QS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgctttaatttaattgtggcagtttgcgagaatttcggaatcggcatcaaaggc
gatctaccatggcgcattaaatctgaactgaagtacttcagccgcaccaccaagcgaaca
agtgatcccaccaagcacaatgccgttgtgatgggcaggaaaacctacttcggagtgccg
gaaagcaagaggcctcttcccgataggctgaacatagtgctgagcaccacacttcaggag
agtgatttgcccaagggagtactcttgtgccccaatctcgagacggccatgaagatcctc
caggagcagaacgaagtggagaacatttggattgtgggcggtagtggagtctacgaggag
gccatggcctcgccaagatgtcaccgtctgtacattaccaaaataatgcagaagttcgat
tgcgacacctttttccccgcgatccctgacagctttcgagaggtcgcgcctgattccgac
atgccactgggtgtgcaggaggagaatggcatcaaattcgagtacaaggttttggagaaa
cagtcataa

DBGET integrated database retrieval system