KEGG   Drosophila sechellia: Dsec_GM15218Help
Entry
Dsec_GM15218      CDS       T01064                                 

Definition
GM15218 gene product from transcript GM15218-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dse  Drosophila sechellia
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dse03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 280 aa AA seqDB search
MLKRKLNQQKGNLEIGEPSKTIPRQDSTSEFFDKPLWLKFYETEVGLNEALEKLPPPERT
PFIYNPIVYASQLHRDYLRRYIDGPKKLVFVGMNPGPNGMAQTGIPFGNVRTVKVLMQLV
GSVDQPPVVHPKRPVVGLDCRIEEPSGVRLWELFLRLAGNMQTFSQQCFVHNFCPLAFFG
ADGRNITPSEIRGTYKKQLGDLCLQTLEEQLKLLKPEVIVAVGEYVHSALKRSGYGKTSS
VSVFRLPHPSPRSPNNTNWPEKAQAFLEEHNLIRFMRNEA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaaactgaaccagcaaaaaggcaatctggagattggggagcctagcaag
acaatcccaaggcaggacagtacatcggaattcttcgataagccgctgtggcttaaattc
tacgaaaccgaagtcgggttaaatgaggcgttggaaaaactacctcctcctgagcgcacc
ccgttcatctacaacccgatagtatatgcgtctcagctgcaccgcgactatttgcgtcgt
tatattgacggtccaaagaagctggtatttgttggcatgaatccagggcccaatggaatg
gcccaaaccggaattccctttggcaatgtgcgcacagtaaaggtcttaatgcagctggtg
ggttcggtggaccaacctccagtcgtgcatcccaaacgtcccgtcgttggcttggattgt
cggattgaggagcccagtggtgtacgtctgtgggagctgttcctccgactggctggcaac
atgcagaccttctcccagcagtgtttcgtccacaatttctgtccgctagctttcttcggc
gcagatggcaggaacataacgcccagtgaaatcagaggaacttacaaaaagcagctagga
gacctgtgcttgcaaaccctggaggaacaactaaagctcctcaaacccgaagtaattgtg
gccgttggggagtatgttcacagcgcactaaagcgttcaggatatggcaaaaccagttct
gtttcggtgttccgactgccgcatcctagtccgcgttcacctaataataccaattggccc
gagaaggcccaagcgtttttggaggagcacaacctaatccgtttcatgcggaatgaggct
tga

DBGET integrated database retrieval system