KEGG   Drosophila sechellia: Dsec_GM15218Help
Entry
Dsec_GM15218      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM15218-PA
  KO
K10800  single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dse  Drosophila sechellia
Pathway
dse03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dsec_GM15218
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dsec_GM15218
DNA repair and recombination proteins [BR:dse03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Dsec_GM15218
 Prokaryotic Type
     Dsec_GM15218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG DUF4918
Motif
Other DBs
NCBI-GeneID: 6616778
NCBI-ProteinID: XP_002041115
FlyBase: FBgn0170138
UniProt: B4IBK5
AA seq 280 aa AA seqDB search
MLKRKLNQQKGNLEIGEPSKTIPRQDSTSEFFDKPLWLKFYETEVGLNEALEKLPPPERT
PFIYNPIVYASQLHRDYLRRYIDGPKKLVFVGMNPGPNGMAQTGIPFGNVRTVKVLMQLV
GSVDQPPVVHPKRPVVGLDCRIEEPSGVRLWELFLRLAGNMQTFSQQCFVHNFCPLAFFG
ADGRNITPSEIRGTYKKQLGDLCLQTLEEQLKLLKPEVIVAVGEYVHSALKRSGYGKTSS
VSVFRLPHPSPRSPNNTNWPEKAQAFLEEHNLIRFMRNEA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaaactgaaccagcaaaaaggcaatctggagattggggagcctagcaag
acaatcccaaggcaggacagtacatcggaattcttcgataagccgctgtggcttaaattc
tacgaaaccgaagtcgggttaaatgaggcgttggaaaaactacctcctcctgagcgcacc
ccgttcatctacaacccgatagtatatgcgtctcagctgcaccgcgactatttgcgtcgt
tatattgacggtccaaagaagctggtatttgttggcatgaatccagggcccaatggaatg
gcccaaaccggaattccctttggcaatgtgcgcacagtaaaggtcttaatgcagctggtg
ggttcggtggaccaacctccagtcgtgcatcccaaacgtcccgtcgttggcttggattgt
cggattgaggagcccagtggtgtacgtctgtgggagctgttcctccgactggctggcaac
atgcagaccttctcccagcagtgtttcgtccacaatttctgtccgctagctttcttcggc
gcagatggcaggaacataacgcccagtgaaatcagaggaacttacaaaaagcagctagga
gacctgtgcttgcaaaccctggaggaacaactaaagctcctcaaacccgaagtaattgtg
gccgttggggagtatgttcacagcgcactaaagcgttcaggatatggcaaaaccagttct
gtttcggtgttccgactgccgcatcctagtccgcgttcacctaataataccaattggccc
gagaaggcccaagcgtttttggaggagcacaacctaatccgtttcatgcggaatgaggct
tga

DBGET integrated database retrieval system