KEGG   Drosophila sechellia: Dsec_GM15254Help
Entry
Dsec_GM15254      CDS       T01064                                 

Definition
GM15254 gene product from transcript GM15254-RA
Orthology
K03099  
son of sevenless
Organism
dse  Drosophila sechellia
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsec_GM15254
   04630 Jak-STAT signaling pathway
    Dsec_GM15254
   04068 FoxO signaling pathway
    Dsec_GM15254
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dsec_GM15254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1580 aa AA seqDB search
MFSGPSGHAHTISYGGGIGLGTGGGGGSGGGGGSQGGGGGVGIGGGGVAGLQDCDGYDFT
KCENAARWRGLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDV
EEKVNKSFPAPIDQWALNEAKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFLV
AVLEYISADILKMAGDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSLP
AQRASATYEETVKELIHDEKQYQRDLHMIIRVFREELVKIVSDPRELEPIFSNIMDIYEV
TVTLLGSLEDVIEMSQEQSAPCVGSCFEELAEAEEFDVYKKYAYDVTSQASRDALNNLLS
KPGASSLTTAGHGFRDAVKYYLPKLLLVPICHAFDDIESFEQGQGLLHSTPLRSSKGYGQ
PCPGSDKFGPAVRVAPPAGIERTLELQMKVEHWEDKDVGQNCNEFIREDSLSKLGSGKRI
WSERKVFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKYFMRRVDINDRPDSDDLKNSF
ELAPRMQPPIVLTAKNAQHKHDWMADLLMVITKSMLDRHLDSILQDIERKHPLRMPSPEI
YKFAVPDSGDNIVLEERESAGVPMIKGATLCKLIERLTYHIYADPTFVRTFLTTYRYFCS
PQQLLQLLVERFNIPDPSLVYQDTGAAGAGGMGGVGGDKEHKNSHREDWKRYRKEYVQPV
QFRVLNVLRHWVDHHFYDFEKDPMLLEKLLNFLEHVNGKSMRKWVDSVLKIVQRKNEQEK
SNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLEFEMYKNVKPSELVGS
PWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQRAIEVMMVMLELNN
FNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDHLKKYQERLRSINPPCV
PFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQNQPYCLNEESTIRQ
FFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPHIPLKSPGIKPRRQNQT
NSSSKLSNSTSSVAAAAAASSTATTIATASAPSLHASSIMDASTAAAANAGSVTLAGEQS
PQHNPHAFSVFAPVIIPERNTSSWSGTPQHTRTDQNNGEVSVPAPHLPKKPGAHVWANNN
TTLASASAMDVVFSPALPEHLPPQSLPDSNPFASDTEAPPSPLPKLVVSPRHETGNRSPF
HGRMQNSPTHSTASTVTLTGMSTSGGEEFCAGGFYFNSAHQGQPGAVPISPHVNVPMATN
MEYRAVPPPLPPRRKERTESCADMAQKRQAPEAPTPTPRDGELSPPPIPPRLNHSTGISY
LRQSHGKCKEFVGNSSLLLPNTSSIMIRRNSAIEKRAAATTQPNQAAAGPISTTLVTVSQ
AVATDEPLPLPISPAASSSTTTSPLTPAMSPMSPNIPSHPVESTSSSYAHQLRMRQQQQQ
QTHPAIYSQHHQHHATHLPHHPHQHHSNPTQSRSSPKEFFPIATSLEGTPKLPPKPSLSA
NFYNNPDKGTMFLYPSTNEE
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atgttctcggggcccagcggccatgcccacaccattagctacgggggcgggatcggtctg
ggcaccggaggcggcggcggcagcggtggtggtggtggctcccagggcggaggcggtggt
gttggcattggcggcggtggcgtggctgggctgcaggattgcgatggctatgacttcacc
aagtgcgagaatgctgcgagatggcggggcttgtttacgccgtcgctgaagaaggtgctg
gagcaagtgcatccacgggtcaccgccaaggaggacgcactgctgtatgtggagaaactc
tgcctgcggctgctggccatgctgtgcgccaagccgctgccccactccgtgcaggatgtg
gaggagaaggtgaacaagtcctttccagcgcccatcgatcagtgggcgctcaacgaggca
aaggaggtgatcaactcgaagaaacgcaagtctgtcctgcccacggaaaaggtgcacacg
ctgctccagaaggatgtgctgcagtacaagatcgatagctccgtgtccgccttcctggtg
gccgtgctcgagtacatctcagcggacatactcaaaatggccggcgactatgtgatcaag
atcgcccactgcgagatcaccaaggaggacatcgaggtggtgatgaacgccgatcgcgtg
ctaatggacatgctcaaccagagcgaagcccacatcctgcccagtcccctgtcactgccc
gcgcagcgtgcaagtgccacctacgaggagacggtcaaggagctgatccacgacgagaag
cagtaccagcgcgacctgcacatgatcatacgcgtctttcgcgaggagctggtgaagatc
gtttccgatccgcgcgagctggaaccgatattctccaacataatggacatctacgaggtg
acggtcactctgctcggctccctggaggacgtcatcgagatgtcccaggagcagagtgct
ccctgcgtgggcagctgctttgaggaactggccgaggcggaggaattcgacgtgtacaag
aagtacgcctacgacgtgacctcgcaggcctcacgggatgctctcaacaatctcctgtcc
aagccaggggcctcatctctgaccacagccggccatggtttccgcgatgctgtcaaatac
tatttgcccaagctgcttctggtgcccatttgccacgccttcgacgacatcgagagcttc
gaacagggtcagggcctgttgcattccactccactgcgatcctcgaaagggtatggccag
ccttgtccagggagcgacaagttcggtccagcggttcgagtggcgccgccagctggcatc
gagcgaacactggagcttcaaatgaaggtggagcactgggaggacaaggacgtgggccag
aattgcaatgaatttattcgagaggattcgctgagcaagcttggatcgggaaaacgaatc
tggagcgagcgcaaggtattcctcttcgacgggctaatggtgctgtgcaaggcaaacacc
aagaagcaaacaccatcggcaggagcaacggcctacgactaccggctgaaggagaagtat
ttcatgcgacgcgtggatatcaacgatcgaccggacagcgatgatctgaagaacagcttt
gagttggcaccccggatgcagccgcccattgtgctgaccgccaagaatgcgcagcacaag
cacgattggatggcagacctgctgatggtgatcaccaaatcgatgctggaccggcacttg
gacagcatactgcaagacatcgagcgaaagcacccgctgcggatgcccagtccggagatt
tacaagttcgcggtgccggacagcggtgacaatatcgtgttggaggagcgcgaaagcgca
ggagtgccaatgatcaagggagcgacgctttgcaagctaatcgagcgcctcacctatcac
atctacgccgatccgacctttgtgcgcaccttcctcaccacatatcgctacttctgctcg
ccgcagcaattgctgcagctgctggtggaacgctttaacataccggatcccagcctggtc
tatcaagacacgggcgcagcaggtgcgggtggaatgggcggcgttggcggtgacaaggag
cacaagaactcgcatcgcgaggactggaagcgatatcgcaaggagtacgtgcagccagtg
cagtttcgagtgctcaacgtgctgcgccattgggtcgaccatcatttttacgatttcgag
aaggatcccatgttgctggagaagctgctcaacttcctggagcacgtgaatggcaaatcg
atgcgcaagtgggtggattccgtgcttaagattgttcagagaaagaacgagcaggagaaa
agcaataagaagattgtatacgcctatggccacgatccgccgcccatcgagcatcacctt
agtgtacccaacgacgagataacgctcctcaccctgcacccattggaactggcccgtcag
ctcacactgctggaattcgagatgtacaagaatgtaaagccgtctgagttggtcggatca
ccctggacgaaaaaggacaaggaggtgaagagccctaacctactgaagatcatgaagcac
accacaaacgtgacccgctggattgagaaatccatcaccgaggcggagaactacgaggaa
cgcctggcaattatgcaacgcgcaatcgaagtgatgatggtgatgctggaattgaacaat
tttaatggaatcctctcgattgtcgcggctatgggcacggcatctgtttatcgactgcgg
tggacattccagggattgcccgaacgctacagaaaattcttggaggaatgccgcgagctc
agcgacgatcatctcaagaagtatcaggagcgattgcgatccatcaatccgccttgtgtg
ccatttttcggtcgctacttgaccaacatactccacttggaggagggtaaccccgacctg
ctagccaacacagagctaattaacttttccaaacgacggaaagtggccgagattattggc
gagattcaacagtaccagaaccagccatactgcctcaacgaggagtccacaattcgacag
ttcttcgagcaactggatccgtttaacggactgtccgacaaacagatgtccgactatctc
tataacgaaagcctgcgcattgagccaagaggctgcaagacggtgccgaaattccctcga
aaatggccgcacattccgctcaaatcgccgggcatcaagccgcgtcgccagaatcagacc
aacagcagtagcaagctgtcgaacagcacgtcgtccgtggcggcggcagcggcagcatcg
tcaacggccaccacaatagccacggcatcagcgccatctttgcacgcctccagcataatg
gatgcgtcaacagcagcagcagctaatgctggatctgtaactctcgccggcgagcaaagt
ccgcagcacaatccgcacgcgttctccgttttcgcccctgttattatacccgaacggaat
accagcagctggagtggaacgccacagcacactcgaacggaccagaacaacggggaggtt
tcggtgccggcgccacatctccccaagaaaccgggcgcgcatgtctgggctaacaacaac
acgacactggccagtgcgtcggcaatggatgttgtgttcagtccagcgctgccagaacat
ctgccaccgcagtccttgccggacagcaatccattcgcatcggatacggaagctccgccg
tcgccgctgcccaagctagtggtcagtccgcgtcacgaaaccggcaatcgatcaccattc
catgggcgcatgcagaacagcccaacgcatagcactgccagtaccgtgaccctaacaggc
atgtctacatcgggcggggaggaattctgcgcgggtggcttctacttcaacagtgcccat
cagggacagccgggggcagtgcccatctcgccgcatgtcaacgttccgatggccaccaat
atggagtaccgagcagtgccgcctccactgccacccagacgcaaggagcgcactgagagc
tgtgcggacatggcgcaaaagcgtcaggcgccagaagcacccacacctaccccgcgtgat
ggcgaactcagtccgccgccgataccgccacggctcaaccattccacgggcatcagctac
ttgcgacagagccacggcaagtgcaaggagtttgtgggcaacagcagtctgctcctgccc
aacaccagcagtattatgatacgccgcaactcggcgatcgagaagcgggcagcggcaact
acccagccaaaccaggcggcggcgggtcccatcagcacgaccctagtgaccgtgtcgcag
gctgtggcgacggacgaaccgctgccgctaccgatctcgccagcggcaagctcctcgacg
accacatcaccgctgacacccgccatgtcgcccatgtcccccaacattcccagccatccg
gtggagagcacgtcgagcagctatgcccaccaactgcgaatgcggcagcagcagcagcag
cagacgcatccagcgatctactcgcagcaccatcaacatcatgccacccatctgccgcac
catccgcaccagcaccattcgaatccgacgcagtcgcgctcgtcccccaaggagttcttt
ccgattgccacgagcctcgagggcacacccaaacttccaccaaaacctagtctaagcgct
aacttctataacaatccagataaaggtacgatgtttctttacccaagtacaaacgaagaa
taa

DBGET integrated database retrieval system