KEGG   Drosophila sechellia: Dsec_GM15256Help
Entry
Dsec_GM15256      CDS       T01064                                 

Definition
GM15256 gene product from transcript GM15256-RA
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dsec_GM15256
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Dsec_GM15256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 633 aa AA seqDB search
MTTPVPRRTKDMMALGLDSDSEDDFNTPYRPRQAAAGERKQQPVASFQVQTKGKENEPHP
LPTNMLPRRVSELTMMDSDSDEEDIKSNHNLNCAILNDSFVLSPSQELTNSNSNITTRRT
SSAVPLKQSDSNLSFLGRFNDMGINCSSQGSPVANSEKQVAKKTAPTLQAAPSATERRPL
QETETPLRNELASTSKTKPDADFITPQVRTIGSTLAGKSRSAVSNDFRAQKVLFQTPMTV
SRAAPVASDSISFSLCDTITESPDIPEPPKKAEPPKNQHPSKKSLDNVFRETDKDNAPVK
VDIVEPKELVLIPAVAVPPEQPSHPSHKTSNILKMKNHEYTIDKKLGCGGSSSVYLARRS
DSGNEFALKVVDLQADPQVVQGYLNETKLLAKLQGNVCVVALYDYQLVREESKLYMVMEK
GDCDLNKILQSYSTNLPLYSLMNILYQMLQAVNYIHQHGVIHSDLKPANFLMVSGRLKLI
DFGIASNIAVDSTSIIKFSQAGTFNYISPEALTDTSTGNSPMRKADQPKIKISTKSDVWS
LGCILYLLLYQKTPFGHIRNVYAKMSAITAPGTSIEYPAIPPYYPIMLVHMAKNCLQLNP
KKRPSCTELLQYPFHMIIPLQNLQIPSRTANSN
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcctgtgccccgccgcaccaaggacatgatggcactgggactggattccgac
tcggaggacgactttaacacgccataccgaccacgacaagcggcggcgggagaacgaaaa
cagcagccagtagcgtctttccaagtccaaacgaaaggcaaggagaacgaaccgcatccc
ctgcccacaaatatgctacctcgccgagtgtccgagttgactatgatggattcggacagt
gacgaggaggacatcaagagcaatcacaaccttaactgcgccatcctaaacgattccttt
gtgctgagcccatctcaagagttaacaaacagcaacagcaacattaccactcgtagaaca
tcaagtgccgtccccctcaaacaatccgattcgaatctctcgttcctgggaagattcaac
gacatgggcatcaattgcagcagtcagggatcacctgttgcgaactcggaaaaacaagtg
gccaaaaagacagcgcccacgcttcaagctgcaccaagtgccaccgaaaggcgcccactc
caagagaccgagacgccactgcgtaatgaattagcctccacctcgaagacgaagccggat
gcagacttcattaccccccaagtgcgaacaataggttccacactggctggaaaaagtcga
agtgcggtgtccaatgacttccgtgcgcagaaagtgctcttccaaacacccatgaccgtg
agtcgtgctgctccagtggcctccgatagcataagcttctccctgtgcgacaccatcaca
gaaagcccggacattccagagcctccgaaaaaggcagaaccaccaaagaatcagcaccct
tccaagaagtccctagataatgttttccgggagacggacaaggataacgcgccagtcaag
gtggatattgtggaaccaaaggagctggtgctgattccggcagttgctgtacctccagag
cagccttcccacccttctcacaagacatctaatattttaaaaatgaagaatcatgagtat
acgattgacaagaaactgggctgtggcggctccagctctgtttatttggcacgccgatcg
gattccggaaatgagttcgccctgaaggtggtggatctgcaggccgatccacaagtggta
caggggtatctaaacgaaaccaaacttctggcaaagctacaagggaacgtttgtgttgtg
gcactttacgattatcaacttgtgcgcgaggagtccaagctgtacatggtgatggagaaa
ggcgactgcgacttgaacaagatcctgcagagctactccaccaaccttcctctctatagc
ctgatgaacatcctgtaccaaatgctgcaagcggtcaactacattcaccaacacggtgtc
atccattcggatctcaagccggcaaatttcctgatggtcagcggcagactgaagttgatc
gattttggcatagccagcaatatcgctgtggactcgacgagcatcatcaaattctcgcag
gcgggcacctttaactacattagtccggaggcgttgacggacacctccacgggaaatagt
ccgatgcgtaaagccgatcagcccaagatcaagatctcgaccaaatcggacgtgtggtcg
ctgggctgcatcctttacctgctactctaccaaaagacaccgttcggccacatccgaaat
gtctatgccaagatgagtgcaatcactgcaccgggcaccagcatcgagtatcccgccatt
ccaccctactatcccatcatgctggttcatatggccaagaactgcctccagctgaatccc
aaaaagcggccgtcgtgcaccgaactattacagtacccattccatatgatcattccgctg
cagaacctgcagatacccagcagaaccgccaacagcaattaa

DBGET integrated database retrieval system