KEGG   Drosophila sechellia: Dsec_GM15285Help
Entry
Dsec_GM15285      CDS       T01064                                 

Definition
GM15285 gene product from transcript GM15285-RA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dse  Drosophila sechellia
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsec_GM15285
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dsec_GM15285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 706 aa AA seqDB search
MHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTAAAQPPAALLSSSERQQQQSTG
YQQVHIIQKLIEQANRVLRAERLKDNAVEKSPSPVQRLGNVRFLRPTQAKKAPLPMSESF
LFEQERLKILEQQQRQRNAGMEELNANAEDERMLSSAERQTQYEHELQRMGVPVVAGIGP
DGPRAPAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLAAH
NAYKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQMRELAESPQSICPSQPQ
SVALLEQMLTQVIELHSQCLGQATPATNVPVAQIRFTHIHIGCDEVQRMGECTTCRQRLR
SELFLSHVVSMAHFIRRQWPHLGVVIWDDQLRSMSLSELQHSQVGSYVEPMVWVYASDIY
RFIQPQLWDTYAKVFPSAWTASAFKGAFGESLLVPPLQHHLENNIRWLAVIAKEGGRFSK
GLRGLALTGWQRYDHFAVLCELLPVGIPSLMTSLSTVSKGYFSTNPRDNELLRVLQCVFQ
PDSRRSGRPWLELHPNAHHSQLFAVCNYPGHLVFKYALRLFDKLAEIRLYLQQTRDQSAW
LSDYNVRHNFSSPLRVRELTDRTPMLIEELRAMAREAQQLLWEVYDEYTVTEFVEQHIYP
TIEALQRQLARAEMLLQRRTWPQRPLPLPLKVQEDMGLVTHQQEQQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcactcaaatctttggatatttatttggcgccggaaactttccttcctgctcgtcgtg
tctggcctggtgcttctcggcctctggacatgggccattctaatcgatacgacagccgca
gcacagcctcctgccgccctactctccagttctgagcgccagcagcagcagtccacgggt
taccagcaggtgcacatcatccagaagctgatcgagcaggccaaccgggtgctgcgagcc
gagcggctcaaggataacgccgtcgagaagtcgccatcgccagtccagcggctgggaaac
gtgcgattcctgcgacccacacaggccaagaaggcgccgctgcccatgtccgagagcttc
ctgttcgagcaggagcgcctcaagattctggagcagcagcagcgccagagaaacgccggt
atggaggaactgaacgccaatgccgaggacgagcgaatgctcagttcggcggagcgacag
acacagtacgagcatgagctccagaggatgggcgtgccggtggtggctggcatcgggccg
gatggtccgagagctcccgccgagcgtctcgttcatctggacctgaagggtgctccccct
aagctaagctttctcaagcagctgctgcccgtgctacgggcattgggagccactggtctg
ctcatagagtacgaggacatgtttccctacagcggagttcttcaaccgctggcggcgcac
aatgcctacaaggaggacgaactacgggacttcctcgagtgcgctgccctccacgggctg
agcgtaatgcccctcgttcaaacctttgggcacatggaatacgtcctcaaactctcgggc
ttcgagcagatgcgtgagctggcggagagtccacagtcgatttgccccagtcagccacag
agcgtggcgctgctggagcagatgctcacccaagtgatcgaattgcattcacagtgcttg
ggtcaggcgacgcccgccaccaacgttcccgtagcacaaatacggttcacccatatccac
atcggctgtgacgaggtgcagcgcatgggcgagtgcaccacctgccgccaaagactgcgc
agcgagctcttcctctcgcacgtggtaagcatggcgcacttcatccgccgacagtggccg
catctgggtgtggtaatctgggacgaccagttgcgatcgatgtccctcagcgagctgcag
cactcgcaagtgggcagctacgtggagccgatggtgtgggtgtacgccagtgacatatac
cgcttcattcagccacagctgtgggatacctatgccaaggtctttcccagcgcctggacg
gcgtcggctttcaagggagcctttggtgagagcttgttggtgccgccgctgcagcatcat
cttgagaacaacatccgatggctggcagtgatcgccaaggaaggcggacgcttctcaaag
ggtttaagaggtctggcactgaccggatggcaacggtacgatcatttcgcagtgctctgt
gaactcctgccggtaggcattcccagtctgatgacgtcgctgtcgaccgtctccaagggc
tacttcagcactaatccgcgggacaatgagctgctgcgtgtgctgcagtgcgtcttccag
ccggacagtcgacgatcgggtcgaccctggctggaactgcatccgaatgcccatcatagt
cagctctttgctgtctgcaactatccgggtcacttggtcttcaaatatgccctgcgcctg
tttgacaagctggccgagatccgactctatttgcagcagacccgcgaccagagcgcctgg
ctctccgactacaatgtgcggcacaactttagttcgccgctgagggtgcgcgaactgact
gacaggacgccgatgctgatcgaggagctgcgggcgatggcgcgggaggcgcagcagctg
ctgtgggaggtatacgacgagtacacggtgacggagtttgtggagcagcacatttatccc
accatcgaggcactgcagcgccagttggccagggcggaaatgctgctccagcgacgcact
tggccacagagaccactgcctctgcccttgaaagtgcaggaggacatgggactggtgacg
catcagcaggagcaacaatga

DBGET integrated database retrieval system