KEGG   Drosophila sechellia: Dsec_GM15538Help
Entry
Dsec_GM15538      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM15538-PA
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dse  Drosophila sechellia
Pathway
dse00511  Other glycan degradation
dse00600  Sphingolipid metabolism
dse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dsec_GM15538
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsec_GM15538
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dsec_GM15538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 6611261
NCBI-ProteinID: XP_002035816
FlyBase: FBgn0170456
UniProt: B4HXF9
AA seq 947 aa AA seqDB search
MAEPLAVETKPLSNGNANGNAVGIAESASAVFQEKMKLQQEEPNEIAAVPKYGLKLKFDH
VWPEKRIQNVRASIRQTLPLVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIG
GIGGGTIGRGYAGEFCRFQMRPGIYEYNVVQANQFIVTIKDPKGCTIFQSLLSKCSTRDK
TSDPDADPDGERTKCQLPNCSSRAKQPLSAWHSNIEDSRCSYTGLYPRSWTEYDLSHYGV
RLTCRQVSPVIPHEYRESSQPCAVFVWSVENVCDQERKVSITFTFKNGTGNKKQDAEGGA
ESQLISEGNAKGVSIRQKIADMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKEH
GQLSEQPTSEALKTKDIGVAVCAQVALKPMASHDLEFVLAWDMPKIQFPRKMQTHTRYYT
KYFDDSGDSGPRICEYALRQYSTWERLIDAWQRPILNDETLPDWYKCAIFNQLYFISDGG
TIWLKCESSLGKELSYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVS
LQYDFKDAIAAELNDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDW
KDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYELYSQDNKRKNSADEK
QQNRKSASMYINETNGKVYLMDAIGYLKAMYASCKAILERTIEYDKDNDGLIENTKMPDQ
TYDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRYQDILEKGKRSLEEKLWNGS
YYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNI
GAANGFIANAGEPTKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKT
LSQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVALERRRAQRD
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacctttagcagtggaaaccaagccgctgagcaacggaaatgccaatggaaac
gcggtgggaatcgccgaatccgccagtgccgtcttccaggagaagatgaagctccagcag
gaggagcccaacgagatcgcggcggtgccgaagtacggactcaagctgaagttcgaccat
gtgtggccggaaaagaggatccagaatgtgcgggcctccatcaggcaaacgctgcccctg
gtgcccctcgtctgcagatatgcggcctactactggaaagtgtcgcgtgaaggtcgccgg
gtgtacatggactactactacatggagaatggcaagcagatctatggagtgcccatcggc
ggaattggaggtggtacgattggcaggggctatgccggcgagttctgccgtttccagatg
cgtcctggcatctacgagtacaatgtggtgcaggccaatcagtttatcgtgaccatcaag
gatcccaaaggatgcaccatctttcagagcctcctctccaagtgcagcaccagggacaag
accagcgatccggatgccgatccggatggggaaagaactaaatgtcaactgcccaattgc
agcagtcgcgccaagcagccgctgagtgcctggcactcgaacatcgaggactcgcgctgc
agctacacgggtctctatccccgctcctggacggagtacgatctgtcccactatggagtc
cgtctgacctgtcgccaggtgtcgccggtaataccgcatgagtaccgggagtccagccag
ccctgtgccgtcttcgtttggagcgtggagaatgtctgcgaccaggagcgcaaggtgtcc
atcacgttcacgttcaagaacggcactgggaataagaaacaggatgcggagggcggagcc
gagtcgcagctaatcagcgagggcaacgccaagggagtctccatcaggcagaagatcgct
gatatgccctgcagctataatctggcatgtagggtccttcccgagatcagcatcacgcgg
tgcccccagttcgatcccgccggcaacggggagcagttgtgggcacagctcaaggagcat
ggccagcttagcgagcagcccacctcagaggcactaaaaaccaaagatataggcgtggct
gtctgtgcccaggtagccctgaagccaatggcatcccacgatctggagtttgtgctggcc
tgggacatgccaaagattcagttccccaggaagatgcagacccacacacgctactacacc
aagtacttcgatgacagcggtgattcgggtcccaggatctgcgagtatgcactcaggcag
tattccacctgggagcgcttgattgatgcctggcaaagacccattctcaatgatgaaacc
cttcccgactggtacaagtgtgccatcttcaatcaactttacttcatctcggatggcgga
accatctggctgaaatgcgaatcctcgctgggcaaggaactgtcatatgatgatccccgt
ttggcttatggccgtttcggttacctggaaggccacgaataccgcatgtacaacacctac
gatgtccatttctatgcatcgccggctctggcccacctgtggcccaatcttcaggtcagt
ctgcagtacgacttcaaggatgccattgccgcagaactaaacgatactcgtaaaatgctt
tacgatggcaaggtgatgccacgcaaggtcaagaactgtgtgccccacgatctcggagat
cccgatgaggaacccttcaccttgatcaactgctacaacattcacgatgtgaatgactgg
aaggatcttaatacgaagtttgtgctgcaggtgtatcgggactactatgtcctcaatgaa
ctggcccaggcccaggcggataatgccagtaagttcagctccatcgagtttatcgataag
gagagcctatatgagctgtacagccaggacaacaagcgcaagaattcagctgatgaaaag
caacaaaaccgtaaatctgcatcgatgtacatcaacgaaaccaatggaaaggtgtatcta
atggacgccattggctacttgaaggccatgtacgcatcgtgcaaggccatcttggagcga
accattgaatacgataaggacaacgacggtctgatcgagaacacaaagatgccggaccag
acctacgactcctgggtgatggacgggccgagtgcctactgctccggcctctggctggct
gctctgcaggccatgtccgccatggctacaatcctggatcagccgaacgattgcctgcgc
tatcaggatattctggagaagggcaagcgatcgctggaggagaagctctggaatggcagc
tactatcgctttgatctttcgcacagtcatcgggatacgatcatggccgatcagttatgt
ggtcattggtatctgaagtcctgcggcttcgattacgagatctatccgaaggagaacgtg
cgtacggcccttaagaggatctatgacaacaatgtgatgggctttcatgagggcaatatc
ggagcggctaatggcttcatagccaatgccggcgaacccaccaagccgggccacgtggac
aacagcaacatccaggcggaggaggtgtggccaggtgtggtttacgctctggctgccacc
atgatacaggagggcatgttcgaggaagccttccagaccgccggcggaatgtacaagacc
ctgtcccagcgcatcggcatgaacttcgagaccccggaagcgttgtacggcgagaagcgc
tatcgctccattggctatatgcgtccgttgagcatttggtccatgcaggtggcattggag
cgacggcgagcccaacgcgactaa

DBGET integrated database retrieval system