KEGG   Drosophila sechellia: Dsec_GM15611Help
Entry
Dsec_GM15611      CDS       T01064                                 

Definition
GM15611 gene product from transcript GM15611-RA
Orthology
K04437  
filamin
Organism
dse  Drosophila sechellia
Brite
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsec_GM15611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1530 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNSDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIVNGNIKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCRITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTQAMDLAQRE
FGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDPVKNFTTDWN
DGRVMCEIIKGLGGSAPAPEKLSTDPFHYENNIRKAVDAGARLGVQPILTAKDMANPEVE
HLGIMAYAAHLQWVPPRPPLSDLVSVYLESTSGRVGEPTHFRIDVMSRDISLSSVRCHVV
PPSGQPGQPVRLNAHGEGVFVPERYGMHEIVVEIGEDSLGGHFFRALPRLLQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVSGELHVDIVHDK
HSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHDSKHRSESPSMHFVSTTNTRHNDYRNSSLSRHNTAERTNSYSPQYSPKLDTTDYHSSS
SRYYKRESEENHATPPQAPPPAGSPTVKYLNSADLYTETLNGRRDSKTSNSSSTKNDYYY
DKENELYSQRRAVTKPKLTPPREERELTSTTNTSSSSSFQQRHQQLATSTLTRSLSPIPS
PTLNTRSSEVHTHSPLTIKTSNQYESSTRNITSSPRHASVSPVQRYSPNSAYITSATHRM
GSPLTIPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTGERLRRTGSPEPRI
DHSSNVRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTEKQLNTELQYNRPDLDH
ETHRNTQYNKFALHKQQQQQSDYRRDSPDDGERYKPSAITVKSHSNNTYTDKSGGYTKTV
KESSEHVVTESNGHGPSPGYGYSSLSRFRPIDGNATGARAIRVQDIPNGSIGRPVEFEID
GSRAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITFNGETVPGSPWHA
EIMSSSGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSKSKLNARVTHE
AANGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVNGGVVGQPCQF
RVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGETVRGCP
FVCAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPQGELPVRVTGDI
HAGFTAEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRGTMGRPVQFTV
DAGDAGEGNLEITISGQRDRTFPRRCIRKR
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaggacataaaaggcgccaaggtgacgcatgcggggctgctcaagcacaac
tccgatggcaccaccgaaacgcagaagatcacccacgccggtctggtggcccggagtccc
gagggcaccgccgccaagggtatgaacatccggggcaacgaggacctctgggtggagatc
caggcgaacacattccgcaactgggtcaacgagcatttgcgcgagacgggaatgcaggtt
catgactgggccaccgatttctgcgatggcacttgtctgtgcgccctcgtggagaacctg
cagacgcgtccactgaaaccctcgtggaatcgccgacccgccaatcagcatcattatctg
gagaacgccaccacggcgctgaagtccatcgaggcggaccacatcaagctggtgaacatc
ggcaacgtggacatcgtgaatgggaacataaagctgatcctgggactgatctggtccctc
atcgtgcgctaccaaatcggaaggagcaagttcccgccgcgcaagctgatgctggcctgg
ctgcaagccgctctgccggactgcaggatcaccaatctgaccaccgattggaatagtggc
gtcaatctggcggcgcttctggactactgccagccgggcttgttcccgcactggcggagt
ctcgatcccagccagagtgtgcgcaactgcacccaggccatggacttggcccagcgcgag
tttggagtgcccaaggttctggagccggagtacctggcctcaccctggttggatgagctg
tccggcatgacgtacctctcgtacttcatgaagcccggtggtcctggttacaatgccacc
atgcgatgggtgaatacgcaggtcaaggaccctgtgaagaactttacgaccgactggaac
gatggacgcgttatgtgcgaaattattaagggactgggtggctctgcgcccgctccggaa
aagctcagcaccgatcccttccactacgagaacaacattcggaaggcggtggacgcggga
gcccggctgggcgtgcagcccatcctgacggccaaggacatggccaacccggaagtggag
cacctgggcatcatggcctacgcggcccacctgcagtgggtgccgccgaggcctccgctg
tccgatctggtcagcgtctacctggagagcacatccggtcgggtgggcgaaccgacccac
ttccgcatcgacgtaatgtcccgggacataagcctcagctcagtacgctgccacgtggtt
cctccgtccggacagccgggacagcccgtgcggctcaatgcccacggcgaaggagtcttt
gtgccggagcgctatgggatgcacgagattgtggtggagatcggcgaggacagcctgggc
ggacacttcttccgagccctgccgcgtttgctgcaggtggctccgccgggaatggcgccc
tgtgccttgggcagtctcgtcgaggtgctggtcaatgccaccggtgcgcccaagacggag
gacatcctggtcacggcggtctcgcccacgggcatctcgcacaattgcccgctgaagaag
atcgacgagggacacagtgccatattcaagccggacgaggcaggtatctgggagatagcc
atcacctaccagggtcgccacatccaaggaggacccttcacctgtgccgtgtttgatgca
tccggagtctcggtccatgggttggatggagccatgccgctgagggcacacaccttcgaa
gtggatgcccgtggagtgggtgtttcgggcgagttgcacgtggacattgtccacgacaag
cattcgctggtctgctcggtggagaagatcgtggagaacaagtaccgggtgacttttatg
cccaggcaaaatggaaagtaccgggtgtacatctacttcaatggctacgatgtcaaaggt
tcgcctttcatcatgcgtgtgggtaccaagggaagatctggcaaaacgcgcagtagtccg
ctgcacgacagcaagcaccgctcggagagtccctcgatgcacttcgtctccaccacgaac
acgcggcacaatgattaccggaactcctcgctttcgaggcacaacacggccgagaggacc
aacagctactcgccccagtactcgcccaagttggacaccactgactaccacagttcgagt
tccaggtactataagcgggagagcgaggagaaccatgccactccgccgcaagctccacca
ccagctggttcccccacggtcaagtacctaaactccgccgatctgtacacggaaactttg
aacgggcgacgggattcgaagacctcgaacagcagctccacgaagaacgactactactac
gacaaggagaacgagctgtacagccagaggcgtgcggtgaccaagcccaagttgacgcca
ccgcgcgaggagcgcgagctgaccagcaccaccaacaccagcagcagcagcagcttccag
cagcgccaccagcagctggccaccagtaccctgaccagatcgcttagtccaatacctagt
cccacactcaatactcgatcaagcgaagtgcacacccacagtccgttgaccatcaagacg
tccaatcagtacgagagttccacgcggaatatcaccagcagtccgcgacacgcctccgtt
tcgcccgtgcaacgttattctcccaatagcgcctatatcacctcggccactcaccgcatg
ggaagtcccttgaccattcccgttagtaagaatggttacgagtcgtcgcgtaccgtagaa
aagtcatcgacctacaagtccacctcgaactacgtcaccgattcgaatattcgtgccagt
ccctcgctttacggaactggcgagcgactgcgtcggaccggatcccccgagccccgcatc
gaccactcctccaatgtgagggtgtcctcgatgaagccggcttccgccaggcgggacagc
tgggacgtcatcaacaagaccaagcacatgctctcgcacaattcgctcgaatcgctggcg
aacatgaccgagaagcagctgaacacggaactgcaatataaccgcccggatttggaccac
gagacgcaccggaacacccagtacaacaagttcgccctgcacaagcagcagcagcagcag
tcggactatcgtcgggattcccccgatgatggagagcgctacaaacccagtgccattaca
gtcaagtcacattcgaacaatacctatacggacaagtccggtggatatacgaaaaccgtt
aaggaatccagcgagcatgtggtcaccgagagcaatggccatggcccctcccctggttat
ggatacagctccctctctagatttagacccatagacggcaatgccactggtgccagggcc
attcgagtgcaggatattccgaatggctctattggacggcctgtcgagttcgagatcgat
ggctcgagggcgggctccggcaatctggagatcctggtcaacggcgggcgtgttacctcc
tcggtgcgctcgctgggaggtcagaggttcatagccagcttcacgccccacgaacatgga
acgcacacggtgcagatcaccttcaatggcgaaacagttccaggttcaccgtggcacgct
gaaatcatgtcctcatccggcctgaccgctctgggcgaatccacgcgcctggtacccgcc
aatacgccggcggtttttgagatactgccgcctcctggacaaagcctgagtaagggcgag
tgcgtggcgacggttttgactcctagcaagtcaaagctgaacgccagagtcacccacgag
gcggcaaatggtgctgctcgcatcgagttcgtgcccaccgaggtgggcacccacgtgatc
gatgcgtccatcaacggcacgaagatcgctggcggcccgctgatcgccaaggtctacgac
tccagcctgatccaggtgacggaggtgaatggcggcgtggtcggccagccgtgccagttc
cgcgtggatgccagcgccgccggcgagggccagctggagatatccatcaacgagggcgag
gtgcccaatcatgtccaggtggtgggcggcggtcgctgcctggtctccttcacgccggag
caggccaagtcgcatctgattgacatcaaatttaacggagaaacggtgcgcggctgtccc
tttgtctgcgccgtggcggacacctcgcgagtgctcctgaatctctccaatctggagcta
atcccagtcaaccggccctcctcctttcacatcaccgtgagcggaggtggagctgccgag
cttgctgtcagcgtgcgcggtccccagggcgagttgcctgtccgggtgaccggagatatc
cacgctggcttcacggccgagttcacgcccaccaccgttggcggccactcgatcaacgtg
gagtacaacggattcgccgtgcaaggaacccccttcctggccaagtcatacgatgccagc
aaggtggtggtgggcagtgtctcgcggggaaccatgggacgtccggtgcagttcaccgtg
gatgcgggcgatgccggtgagggcaaccttgagatcacgatttcgggtcaaagggacaga
acattcccacgcaggtgcatccgcaaacgctag

DBGET integrated database retrieval system