KEGG   Drosophila sechellia: Dsec_GM15612Help
Entry
Dsec_GM15612      CDS       T01064                                 

Definition
GM15612 gene product from transcript GM15612-RA
Orthology
K04437  
filamin
Organism
dse  Drosophila sechellia
Brite
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsec_GM15612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1401 aa AA seqDB search
MPVPGCPIAVSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGPAGQSVP
AQVHQSADGVFKAEFVPRVVGEHRVNVTVNGLPTAGSPYAAKVYDVSAIKVKNVSSGTVG
KAVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAESHTVELRFNSQD
VPGSPFTCRVAAAARIQSPETMDKVSVGRLFEFVVESDTKPTVEVLGPARRSVPVKIDAL
GTSTLGYNVKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSAEKVIVTDIRAGVVNKSV
SFGINASQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKPTEAATHSLSVRFNGHPV
PGSPFSCHIAAAAASPSMGLPRAMAMGECLKQAAVKMDNTFELEGFEGVEPQIFVTSPSG
DNEHCQLSQHDGGSYSASFRPTTVGRHLISVTANDQHINGSPFSCNVFDVSRVSISGLEQ
QYGPANLGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACARGLYDVTFVPQSTEPH
YVNITFNEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPADDQIVEIFSPDQKSVPYSINR
QTAEFRTHMTGNYTLRFIDRETRQHIGSRTLCVFDPTLVKITEVSEAFCHRPASIGVSLN
EAGQGDLSALVRCGATEVPHTIRGPSKTGVYEIVYQPTRVAPHKISILFNEVPISLKPLE
INVLPASAGKEISVSGLGLYQSRVGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVRCYQ
TKNGHLQAEFTINKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVSTQGVTKEPLALHSPN
SFTVRTDNAGTAELEAFAISPSNQSIPVLISEQSDGVYNVEFVPSQPGNYKLTLMYGGET
IPSSPLTFTASSSGVRNDARAAGHGLEVCHRNKEASFVVYCPIAPNVQIERLDEYGERIE
PKIKALGNNEWRISYTILSVGKYEIRASCPNRGSLPGSPWHISCVESNKVTPVGGWGTLV
DHDGRLILPARIIFDVENAGPGKLVCSIDGIEIPVDKLVDGKMCLNITGENLAAGEHDLD
LTWSGLTITQCPRSAFVTGQQAADKVQLMGRGLAAAQAGEAAHFTIDASNAPAGRPEVIL
TSQDSTSLPVSLAQPRPSENIWLASYTPLKSTTGTLNLSVKWNGRLVKGCPLTVAVGSSM
DASKVIVSGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGVRKVAYCELYDHGDATFTL
NIKPQESGRHILTINYGGQNVPGSPFALKVAGAPDASKVRVYGPGIEHGVLATFQSRFIC
DTRGAGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGEFVPG
SPFPVMIFDTEEELRRYLQGI
NT seq 4206 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttcccggctgtccgatagcggtcagcatcagtgggggcgtggccgggccccag
gtgtccctgggtggcccaggacccgtgcaccagaccaattcttttgtaatcaatcacaat
ggcggccgtttggaggacatcgaggtgaacgtggaaggacctgctggccaatcggttccg
gcgcaagtacatcagtccgcagatggcgtcttcaaggcggagttcgtgcccagagtcgtg
ggcgagcaccgggttaatgtcacggtcaacggattacccaccgccggaagtccatatgca
gccaaagtctacgatgtcagcgccatcaaggtgaagaatgtgagtagtggcacagtgggc
aaggctgtcacattcctcgtggagacatcccaggctggacccggaaacctagaggtgacc
gtcaacggaggcagggttccaacttcagcccaagcccagggtcagcacacgtatgccatc
agcttcacgccccgcgaggctgagagtcacacggtggagctgcgcttcaatagccaggat
gttccgggatcccctttcacttgccgtgtggctgctgccgctcgtatccaatcgccggag
accatggacaaggtcagcgtgggacgacttttcgagttcgtggtggagtcggacactaag
ccgacggttgaggtactcggtcctgccaggcgtagtgtgcccgtgaagatcgacgcattg
ggtacctccaccctgggctacaatgtcaagttcgagcccatggaagtaggcgaccactcg
gtggaggttcgtctgcccggcggtggtcacgtggagggcagtccgttcctactgaaggcc
tattccgccgagaaggttatagtcaccgatatccgtgctggtgtggtcaacaagagtgtg
agcttcgggatcaatgcctcgcaggcaggagccggcaacctggagataattgtggccgtc
aatggcaagaacgtgcccaactttgtccaatctgagggcaatgctcggttcaaggtgaac
ttcaagcccacggaggcggccacccactcgctgtcggtgcgattcaatggacatcctgtg
ccgggttcaccatttagctgtcacatcgcagctgccgcggcttcgccctcgatgggattg
ccacgggccatggccatgggagaatgcctgaagcaagctgccgtcaagatggacaacacc
tttgagctcgaaggctttgagggcgtggagcctcagatctttgtgacctcgccatcaggg
gacaatgagcactgccagttgagtcagcacgacggaggtagttactccgcttcgttccgc
cccaccactgtgggtcgccacctgatcagtgtgacagccaacgatcagcacatcaacgga
tcacccttcagttgcaacgtgtttgacgtctccagggtgagcatcagtggactggagcag
cagtatgggccagccaacctgggcgttccagttaccttcagcgttgacgctgcaggagct
ggtgaaggaaccctggagctggtggtttccacggacagcagcactgttaaggcagaggtg
gtggcctgtgcccgcggtctgtacgatgtgaccttcgtgccccagagcacagaaccccac
tatgtgaacatcactttcaacgaggtggccgtggacggaagccccttccgcgtggacata
cagcagcacacgcagcatattcagatcggtagtttggcggccattgatttcccagcggac
gatcagatcgttgagatattctcgccggatcagaagtctgttccgtattcgattaaccgg
cagacagccgagttccggacccacatgaccggtaactacactttgcgtttcattgatcgc
gagacccgtcagcacattggatcccgaacgttgtgcgtctttgatcccacgctggtgaag
atcactgaggtgagcgaggccttctgccatcgtccagccagcattggagtgtccttgaac
gaagctgggcagggagacctttcggctttggtgcgttgtggcgccaccgaagtaccccac
accattcgcggacctagcaagacgggagtatatgaaatagtttaccagcccacgcgtgtt
gctccccacaagatcagcatcctcttcaacgaagtgcccatttccctaaaacccctggag
atcaatgtcctgcccgccagtgctggcaaagaaatcagtgtcagtggtcttggattgtac
cagtcgcgagtgggaaagaccacttcctttgccattgatacagtcaaaaggccagctagg
gagttcgatgtggtggtctccggaccaggaggacaagctcttccggtcagatgttatcag
acaaagaacggacacctgcaggcggagttcaccatcaacaagccgggacagtgtgtcatt
gaggtactccaccaatcgaaacctctgcccggaagcccatttacgtgtgaatcctttgac
agcagcaaagtcagcacacaaggggtcactaaggaaccactggcccttcacagtccaaac
agtttcacagtacgcacggataatgccggaaccgccgaactggaagcgttcgccatatcg
ccaagcaatcagagcattcccgttttaattagtgagcaatctgatggagtctacaacgtg
gagtttgtgccctcgcagccgggcaactacaagctgaccctcatgtacggaggcgaaacg
attcctagttcaccactgacctttaccgcctcgtccagtggcgtaagaaatgatgcccgt
gccgccggacacggactggaggtgtgccaccggaacaaggaagcatccttcgttgtctac
tgccccatcgccccgaacgtccagatcgaacgattggatgagtatggcgagcggatagag
cccaagatcaaggctctgggcaacaatgagtggcgaatctcctacacaattctgtccgtg
ggcaaatacgagatcagagctagctgtccaaacaggggaagcttgccgggatcgccgtgg
cacatcagttgcgtggaatccaacaaggttacacctgtgggtggttggggtactctcgta
gatcacgacggccgtctgattctgcccgctcgaattattttcgacgtggaaaatgcgggg
ccaggaaaactggtttgcagcattgatggcatcgaaataccggtggacaagttggttgac
ggtaagatgtgtctgaacatcactggcgagaacctggctgccggcgagcatgacttggat
ttgacttggagcggcttaactatcacccagtgccccaggagtgccttcgtcaccggtcaa
caggcggcggataaggttcagctcatgggtcggggtctggctgcagctcaagctggggag
gcagcgcacttcacaatcgatgcctccaatgcgcccgctggcagaccggaggtgatcctc
accagccaggacagcacgtcgctgccagtgagcttggcgcaaccgaggccaagcgaaaac
atctggctagcctcctacactccactgaaatccacaactggcactctaaatctctctgta
aagtggaacggtcgtttggtcaagggatgtccgctaacagtggcagtgggctcttcaatg
gatgcctcaaaggtgatagtctccggtgagggactgcgtcacggtattgtgggcaaggac
ataaagtcttggatagacaccaggagagcaggacccggcgaactcaccgcccattgtgct
ggtgtacggaaagttgcctactgcgaactatacgatcatggagatgcaactttcaccctg
aacatcaagccccaggaatcaggtcgtcatatcctaaccatcaattacggtgggcaaaat
gttcccggctcgccattcgcactgaaagtggccggtgcaccggatgccagtaaggtccgc
gtttatggacctggaatcgagcatggcgtgctggccacattccagtcgcgcttcatctgc
gacactcgcggagcgggagctggtcaactgacagttagggtccgtggacccaaaggagct
tttcgcgtggagatgcagcgagagagtcagaaagatcgcaccatactgtgcaagtacgat
ccaaccgaaccgggcgactatcgagtggaggtcaaatgggcaggcgaattcgtgccagga
tcgccgttccccgtcatgatcttcgacactgaggaggagttacgaaggtacttacagggc
atatga

DBGET integrated database retrieval system