KEGG   Drosophila sechellia: Dsec_GM15656Help
Entry
Dsec_GM15656      CDS       T01064                                 

Gene name
Dsec_Adh
Definition
(RefSeq) Adh-PA
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dse  Drosophila sechellia
Pathway
dse00010  Glycolysis / Gluconeogenesis
dse00071  Fatty acid degradation
dse00350  Tyrosine metabolism
dse00830  Retinol metabolism
dse00980  Metabolism of xenobiotics by cytochrome P450
dse00982  Drug metabolism - cytochrome P450
dse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM15656 (Dsec_Adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Dsec_GM15656 (Dsec_Adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dsec_GM15656 (Dsec_Adh)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsec_GM15656 (Dsec_Adh)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsec_GM15656 (Dsec_Adh)
   00982 Drug metabolism - cytochrome P450
    Dsec_GM15656 (Dsec_Adh)
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dsec_GM15656 (Dsec_Adh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR ThiF
Motif
Other DBs
NCBI-GeneID: 6611292
NCBI-ProteinID: XP_002035839
FlyBase: FBgn0012780
UniProt: Q9GN94
AA seq 256 aa AA seqDB search
MAFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVT
FYPYDVTVPIAETTKLLKTIFAKLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAI
LDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYT
VNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDL
GTLEAIQWTKHWDSGI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttactttgaccaacaagaacgtgattttcgttgccggtctgggaggcattggt
ctggacaccagcaaggagctgctcaagcgcgacctgaagaacctggtgatcctcgaccgc
attgagaaccctgctgccattgccgagctgaaggcaatcaatccaaaggtgaccgtcacc
ttctacccctatgatgtgaccgtgcccattgccgagaccaccaagctgctgaagaccatc
ttcgccaagctgaagaccgtcgatgtcctgatcaacggagctggcatcctggacgatcac
cagatcgagcgcaccattgccgtcaactacactggcctggtcaacaccacgacggccatt
ctggacttctgggacaagcgcaagggtggtcccggtggtatcatctgcaacattggatcc
gtcactggattcaatgccatctaccaggtgcccgtctactccggcaccaaggccgccgtg
gtcaacttcaccagctccctggcgaaactggcccccattaccggcgtgaccgcttacacc
gtgaaccccggcatcacccgcaccaccctggtgcacaagttcaactcctggctggatgtt
gagccccaggttgccgagaagctcctggctcatcccacccagccctcattggcctgcgcc
gagaacttcgtcaaggccatcgagctgaaccagaacggagccatctggaaactggacttg
ggcaccctggaggccatccagtggaccaagcactgggactccggcatctaa

DBGET integrated database retrieval system