KEGG   Drosophila sechellia: Dsec_GM15702Help
Entry
Dsec_GM15702      CDS       T01064                                 

Definition
GM15702 gene product from transcript GM15702-RA
Orthology
K14298  
mRNA export factor
Organism
dse  Drosophila sechellia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM15702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 346 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKC
HRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgccacacaatcgacgaaccggatgaacgacttcgaggtcgcctctccgccg
gacgactccgtctcggcgctggagttcagccccagcacggtgcagaagaacttcctggtg
gccggtagctgggacagcaccgtccgctgctgggaggtggaacaaaacggggccaccgtg
cccaagtcgatgaagaccatgggcggaccagtgctggacgtttgctggtcggacgatggc
agcaaggtgttcgttgcctcctgcgacaagcaggtgaagctctgggacctcgcctccgac
caagtgatgcaggtggcggcccacgacggtcccgtgaaaacgtgccacatggtcaagggt
cccacgtacacctgcctgatgaccggctcctgggacaagaccctaaagttctgggacacc
cgttcgcccaatcccatgatgaccatcaatctacccgagcggtgctactgcgccgatgtg
gagtatccgatggccgtggtgggcacggccaacagaggactcatcatatactcgcttcag
aacagccccaccgagtacaagcgacaggagagtccgctgaagtaccagcaccgtgccatt
tccattttcagggacaagaagaaggagcccacgggctgtgcgctgggcagcattgagggc
cgtgttgccattcagtatgtaaatccggggaatcccaaagataacttcactttcaagtgc
caccgtaccacgggcacctcaggctaccaggacatatatgcagtaaatgacatcgcattc
caccctgtgcacggcaccctggtgaccgttggctcagatggcaccttcagtttctgggac
aaagatgcccgaaccaagctcaagtccagcgagaccatggatcagtctattaccaaatgc
ggatttaacgccaatggccagatatttgcgtacgccgtcggctacgactggtcgaagggc
cacgagtacttcaacccggccaagaagccccaaatctttctgcgctcgtgctacgacgag
ctcaagccgcgcattaactga

DBGET integrated database retrieval system