KEGG   Drosophila sechellia: Dsec_GM15702Help
Entry
Dsec_GM15702      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM15702-PA
  KO
K14298  mRNA export factor
Organism
dse  Drosophila sechellia
Pathway
dse03013  RNA transport
Module
dse_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM15702
Messenger RNA biogenesis [BR:dse03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dsec_GM15702
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dsec_GM15702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Nup160 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 6615412
NCBI-ProteinID: XP_002039794
FlyBase: FBgn0170618
UniProt: B4I7T4
AA seq 346 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKC
HRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgccacacaatcgacgaaccggatgaacgacttcgaggtcgcctctccgccg
gacgactccgtctcggcgctggagttcagccccagcacggtgcagaagaacttcctggtg
gccggtagctgggacagcaccgtccgctgctgggaggtggaacaaaacggggccaccgtg
cccaagtcgatgaagaccatgggcggaccagtgctggacgtttgctggtcggacgatggc
agcaaggtgttcgttgcctcctgcgacaagcaggtgaagctctgggacctcgcctccgac
caagtgatgcaggtggcggcccacgacggtcccgtgaaaacgtgccacatggtcaagggt
cccacgtacacctgcctgatgaccggctcctgggacaagaccctaaagttctgggacacc
cgttcgcccaatcccatgatgaccatcaatctacccgagcggtgctactgcgccgatgtg
gagtatccgatggccgtggtgggcacggccaacagaggactcatcatatactcgcttcag
aacagccccaccgagtacaagcgacaggagagtccgctgaagtaccagcaccgtgccatt
tccattttcagggacaagaagaaggagcccacgggctgtgcgctgggcagcattgagggc
cgtgttgccattcagtatgtaaatccggggaatcccaaagataacttcactttcaagtgc
caccgtaccacgggcacctcaggctaccaggacatatatgcagtaaatgacatcgcattc
caccctgtgcacggcaccctggtgaccgttggctcagatggcaccttcagtttctgggac
aaagatgcccgaaccaagctcaagtccagcgagaccatggatcagtctattaccaaatgc
ggatttaacgccaatggccagatatttgcgtacgccgtcggctacgactggtcgaagggc
cacgagtacttcaacccggccaagaagccccaaatctttctgcgctcgtgctacgacgag
ctcaagccgcgcattaactga

DBGET integrated database retrieval system