KEGG   Drosophila sechellia: Dsec_GM15739Help
Entry
Dsec_GM15739      CDS       T01064                                 

Definition
GM15739 gene product from transcript GM15739-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dse  Drosophila sechellia
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsec_GM15739
   00053 Ascorbate and aldarate metabolism
    Dsec_GM15739
   00500 Starch and sucrose metabolism
    Dsec_GM15739
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsec_GM15739
   00860 Porphyrin and chlorophyll metabolism
    Dsec_GM15739
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsec_GM15739
   00982 Drug metabolism - cytochrome P450
    Dsec_GM15739
   00983 Drug metabolism - other enzymes
    Dsec_GM15739
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsec_GM15739
Glycosyltransferases [BR:dse01003]
 Others
  Hydrophobic molecule
   Dsec_GM15739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 530 aa AA seqDB search
MQFPLLFGLLLAGTLYSQLELGEGSKILAVYAFPGKSHFMMHTALIRELVESGHQVTMVT
AFTLAKEQLGSNYTEILIEPVYDFWHDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTT
EHALRQPKVRALIHAEQKEGVFDLLLAEQFYQEAFLALAHLYKVPVVTTSTLGYENHMSQ
MMGLITPWSFVPHGFMPFTDRMSFLERVKNSYASFYEDMDRLLNYFPKMDAVAREFFGPV
LAEVPKVRHMEREISVMLLNSHAPLTTTRPTVDAMVPVGGMHIYPPKALPADMQAFLDGA
TEGAIFFSLGSNVQSKDMPVEMLRLFLQVFGSLKQRVLWKFEDESISQLPDNVMVRKWLP
QADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAVLGGYAISLHFQ
SITDEILRHSLDQLIHNATYKENVQRVSDIFRDRPLEPRKSAVYWIEYVIRHRGAPHMRS
AGLDLNWFQFYLLDVIAFVAIIALAGVMALSLAIRLLMGSNKKHRKAKLN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccattattatttggtctccttttggcgggaacattatattcccagttggaa
ttaggcgaaggatcgaaaatcctggctgtgtatgcctttccgggaaaatcccattttatg
atgcacactgctctgataagggaacttgtcgaaagtggtcatcaggtgaccatggtaaca
gcttttactctggcgaaagagcaactgggcagcaactacacggagatcttgatagaaccg
gtctacgatttctggcacgatgttaagctgaattttggagcccagcacctattcgagctg
acccgcatgaccaactatgatttcctcaagatgctggagatcatcggcctcaagaccacc
gaacatgccctgcggcagcccaaggttcgggctctcattcatgccgagcagaaggagggg
gtcttcgatcttctcctggccgagcagttctatcaggaggccttcttggcactggctcat
ctgtacaaagtacccgtggtgaccacgagcactttgggctatgagaaccacatgagtcag
atgatgggtctgattacaccttggtcctttgtaccgcacggttttatgcccttcaccgat
cgcatgagtttcctggagagagtgaagaactcctatgcatccttctacgaagacatggac
aggctgctgaactattttccgaaaatggatgcggtggccagggagttctttggacccgta
ctggccgaggtgcccaaggtcaggcacatggagcgggaaatctcagtgatgctactaaac
agtcacgcaccgctgaccacgacacgtcccacagtggacgccatggtgccagtgggcggg
atgcacatctatccacccaaagcgctgccggctgacatgcaagcctttctggatggcgcc
accgagggggccatcttcttcagcctgggcagcaatgtccagagcaaggacatgcccgtg
gaaatgctgcgactgttcctgcaggtattcggttcgctcaagcagcgggtattgtggaaa
ttcgaggacgagagcattagccaattgccagataacgtgatggtcaggaagtggctgcca
caggcggacattctggcccatcgtcatgtgaaggtattcattacccacggtggcttgttt
ggcactcaggagggagtgcattatgctgtgcccatgctgggtattcccttctactgtgat
cagcaccttaatatgaacaaagctgttttgggtggatatgccattagtctgcacttccag
tcgattaccgatgaaatcctgcggcactccttggaccaacttatccacaatgcaacctac
aaagagaacgttcagagggtatcggatattttccgggatcgtccgctggagccgcgaaaa
agtgccgtctactggatcgaatatgttatccggcatcgaggtgctccacatatgagatct
gcaggcctggatctcaactggttccaattctacttgctggatgtcatagcttttgtggct
attattgctttagctggagtcatggctctctcattggccattcgattactgatgggcagt
aataagaaacacaggaaagctaagctaaattaa

DBGET integrated database retrieval system