KEGG   Drosophila sechellia: Dsec_GM15814Help
Entry
Dsec_GM15814      CDS       T01064                                 

Definition
GM15814 gene product from transcript GM15814-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dse  Drosophila sechellia
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsec_GM15814
Enzymes [BR:dse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dsec_GM15814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 273 aa AA seqDB search
MKPQTSEQNGSGQNGEGAADAVAVATIPTGEASAASATSGTDLTVSKSSQQLKLDMLNLE
LASNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERA
AKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLP
CNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGV
QKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccagaccagcgagcaaaacggcagtggccaaaatggcgagggtgccgcggat
gccgtggccgttgccacgatccccacgggcgaagcctccgccgcctccgccacgtccggc
accgatctaacggtctccaaaagcagccagcagctgaaactggacatgctcaacttggag
ctggccagcaatggaagcggccacgagaagtgcacgttccatcatgacctggagctggac
cacaagccgccgacgcgggaggcccttctcccggacatggcacgctcgtatcgcctactc
ttgggcggcctgggcgagaatcccgatcgccagggactgatcaagacgccggagcgggcg
gccaaggccatgctgtacttcaccaagggctacgaccagagtctcgaggatgttctcaat
ggcgccgtgttcgacgaggatcatgacgaaatggtggtggtcaaggatattgaaatgttc
tccatgtgcgagcatcatctggtgcccttctacggcaaagtttccatcggttacttgccg
tgcaacaagattctcggactcagtaaattggcacgcattgtcgaaatattttcgcgtcgc
ctgcaagtccaggagcgcttgactaagcagatcgctgtggccgtgactcaggccgtgcaa
cccgctggagtggcagtggtcgtagagggagtccacatgtgcatggtgatgcgtggcgtg
cagaagatcaacagcaaaactgttacctcaactatgctgggcgtgttccgagacgatccc
aagacccgtgaggaattcctgaacttagtcaatagcaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system