KEGG   Drosophila sechellia: Dsec_GM15814Help
Entry
Dsec_GM15814      CDS       T01064                                 

Definition
GM15814 gene product from transcript GM15814-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dse  Drosophila sechellia
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dse00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 273 aa AA seqDB search
MKPQTSEQNGSGQNGEGAADAVAVATIPTGEASAASATSGTDLTVSKSSQQLKLDMLNLE
LASNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERA
AKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLP
CNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGV
QKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccagaccagcgagcaaaacggcagtggccaaaatggcgagggtgccgcggat
gccgtggccgttgccacgatccccacgggcgaagcctccgccgcctccgccacgtccggc
accgatctaacggtctccaaaagcagccagcagctgaaactggacatgctcaacttggag
ctggccagcaatggaagcggccacgagaagtgcacgttccatcatgacctggagctggac
cacaagccgccgacgcgggaggcccttctcccggacatggcacgctcgtatcgcctactc
ttgggcggcctgggcgagaatcccgatcgccagggactgatcaagacgccggagcgggcg
gccaaggccatgctgtacttcaccaagggctacgaccagagtctcgaggatgttctcaat
ggcgccgtgttcgacgaggatcatgacgaaatggtggtggtcaaggatattgaaatgttc
tccatgtgcgagcatcatctggtgcccttctacggcaaagtttccatcggttacttgccg
tgcaacaagattctcggactcagtaaattggcacgcattgtcgaaatattttcgcgtcgc
ctgcaagtccaggagcgcttgactaagcagatcgctgtggccgtgactcaggccgtgcaa
cccgctggagtggcagtggtcgtagagggagtccacatgtgcatggtgatgcgtggcgtg
cagaagatcaacagcaaaactgttacctcaactatgctgggcgtgttccgagacgatccc
aagacccgtgaggaattcctgaacttagtcaatagcaaatag

DBGET integrated database retrieval system