KEGG   Drosophila sechellia: Dsec_GM15830Help
Entry
Dsec_GM15830      CDS       T01064                                 

Definition
GM15830 gene product from transcript GM15830-RA
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dse  Drosophila sechellia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dsec_GM15830
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dsec_GM15830
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     Dsec_GM15830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1114 aa AA seqDB search
MFWAGVRYERVQGDGPRVKEISEKHSVFMVYFTHTGTQGKSLTEIEADMYTKAGEFFMAH
NGWVMGYSDPLRDFAEEQPGRANVYLKRELISWGDSVKLRFGRRPEDSSYLWQHMTEYVQ
TTARIFDGVRLDNCHSTPLHVAEYLLDAARKINPELYVVAELFTNSDYTDNVFVNRLGIT
SLIREALSAWDSHEQGRLVYRYGGVPVGGFQANSSRHEATSVAHALFLDLTHDNPSPVEK
RSVYDLLPSAALVSMACCATGSNRGYDELVPHHIHVVDEERTYQEWGKGVDSKSGIMGAK
RALNLLHGQLAEEGFSQVYVDQMDPNVVAVTRHSPITHQSVILVAHTAFGYPSPNAGPTG
IRPLRFEGVLDEIILEASLTMQSDKPFDRPAPFKKDPNVINGFTQFQLNLQEHIPLAKST
VFQTQSYSDGNNTELNFANLRPGTVVAIRVSMHTGPRTSFDKLQKISNALRIGSGEEYSQ
LQAIVSKLDLVALSGALFSCDDEERDLGKGGTAYDIPNFGKIVYCGLQGFISLLTEISPK
NDLGHPLCNNLRDGNWMMDYIADRLTSYEDLKPLSAWFKATFESLKNIPRYLIPCYFDAI
VSGVYNVLINQVNELMPDFIKNGHSFPQSLALSTLQFLSVCKSANLPGFSPALSPPKPPK
QCVTLSAGLPHFSTGYMRCWGRDTFIALRGSMFLTGRYNEARFIILGFGQTLRHGLIPNL
LDSGSKPRFNCRDAIWWWMYCIKQYVEDAPKGAEILKDKVSRMFPYDDADAHAPGAFDQL
LFDVMQEALQVHFQGLQYRERNAGYEIDAHMVDQGFNNQIGVHPETGFVFGGNNFNCGTW
MDKMGSSQKAGNKGRPSTPRDGSAVELVGLQYAVLRFMQSLADKEVIPYTGVERKGPSGE
VTKWSYKEWADRIKNNFDKYFFVSESETCSVANKKLIYKDSYGATQSWTDYQLRCNFPIT
LTVAPDLCNPQNAWRALERAKKYLLGPLGMKTLDPEDWNYRANYDNSNDSTDCTVAHGAN
YHQGPEWVWPIGFYLRARLIFAKKCGHLDETIAETWAILRAHLRELQTSHWRGLPELTND
NGSYCGDSCRTQAWSVAAILEVLYDLHSLGADVA
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgttttgggccggagttcgctacgaaagagtccagggcgatgggcccagagtgaaggag
atctccgagaagcactcggtctttatggtctactttacgcataccggcacccaaggaaaa
tcgctcactgagatcgaggctgatatgtacaccaaggctggagagttcttcatggcccac
aatggttgggtcatgggatacagcgatcctctgagggactttgctgaagagcaacctgga
cgcgccaatgtctacctcaagcgcgagctcatctcgtggggcgatagtgtgaagttgcgc
ttcggcaggcggccggaggacagttcctacctgtggcagcacatgaccgagtacgttcag
accacggcgcgcatcttcgacggtgtgcgattggacaactgccactccacgccattgcac
gtagctgagtaccttctcgatgcggctcgtaagatcaacccagagctgtatgtggtggcg
gaactgttcaccaattccgattacaccgacaatgtgtttgtgaaccgattgggcatcacc
tccttgatacgtgaagctctctccgcttgggactcgcatgagcaaggccgcctagtgtat
cgttatggaggagtgcctgtgggtggtttccaagcgaattcatcgcgccacgaggccacc
agtgtggctcatgccctcttcctagaccttacccacgataacccgtctccggtggagaag
cgttccgtgtacgatcttctaccatcggcagcactggtttccatggcctgctgtgccaca
ggaagtaaccgtggttacgacgaactggttccacatcatatccatgtcgtagacgaggaa
cgtacgtaccaagaatggggcaaaggtgttgactcgaagtctggaattatgggtgccaaa
agagcactgaatttgctgcatggacagctcgcagaggagggatttagccaagtgtacgta
gaccagatggatcccaacgtagttgcagttactcgtcattcgccgatcacgcatcagtca
gttattctggtggcccacactgcctttggctatccctctccaaatgccgggcccaccgga
atccgcccgctgcgtttcgagggtgtgttggacgagatcatcctggaggccagcttgacc
atgcagagtgacaagcccttcgatcgtcccgctccatttaaaaaggatccgaatgtgatc
aatggctttactcagttccagttgaatctgcaggaacacatcccgctggctaagtcgacg
gtgttccagacccaatcctattcggatggcaacaacacggagctaaactttgccaatcta
cgacccggcactgtggtggccatcagagtgtccatgcatactggtcctcgcacgagtttc
gataagctccaaaagatttcgaacgccctgcgtattggatcaggcgaggagtattcccag
ctgcaggctatcgtctccaagttggatctggtggcacttagtggtgccctcttcagctgc
gatgatgaggagagggatctgggcaaaggtggcaccgcctacgacattcccaactttgga
aagatcgtttactgcggactgcaaggattcatttccttgttgacggagatttcgcccaaa
aatgacttgggacatccgctttgtaacaatctgcgcgatggaaactggatgatggattac
attgctgatcgcctaactagttacgaagacctgaagccactctccgcctggttcaaagct
acctttgagtcactgaagaatattccacgctacctcataccctgctactttgatgccatt
gtcagcggggtttacaatgtgctcatcaaccaggtcaacgaactaatgccagacttcatt
aagaatggccacagcttcccacaatccctggccctgtccacgttgcagttcctctccgtt
tgcaagtcggccaatttgccaggattcagtcctgctctaagtccacccaagcctccaaag
caatgtgtgactctttctgctggactgccgcatttctcaacgggctatatgcggtgctgg
ggccgtgataccttcatcgctctgcgtggctccatgttcctcactggccgttacaacgaa
gcccgcttcatcatccttggatttggtcagacccttcgacacggactaattccgaatctt
ttggacagcggcagcaagccgagattcaattgccgcgatgccatctggtggtggatgtac
tgcatcaagcagtatgtggaggatgcccccaagggtgctgagatcctgaaggacaaagtg
tcccgcatgttcccgtacgacgatgcagatgcccatgctccaggagccttcgaccagctt
ctcttcgatgtaatgcaggaggcactgcaggtgcattttcagggcttgcagtatagggag
cgcaatgcaggctatgagatcgatgcgcacatggtggaccagggctttaacaatcagatc
ggagttcacccggagactggctttgtgttcggaggcaataacttcaactgcggcacttgg
atggataaaatgggatcctcgcagaaggccggaaacaagggacgaccaagtacgccgcgt
gatggatccgcagtggagctcgttggcctacagtatgccgtgctccggtttatgcaaagc
ctagccgataaggaggttattccgtacaccggcgtggaacgaaagggtccatcgggcgaa
gtgaccaagtggagctacaaggagtgggcggatcgcatcaagaacaactttgacaagtat
ttctttgtgtccgagtcggaaacctgctcggtggccaacaagaagcttatctacaaggac
agctatggagccacccagagttggacggactaccagctgcgatgcaacttccccatcacc
ttgaccgtggctcccgatctgtgcaatcctcagaatgcctggcgtgcactggagcgcgcc
aaaaagtatcttctgggaccgctgggcatgaagacgctggatcccgaggactggaactat
agggccaactatgacaactcaaatgactccacggactgcactgtggcccatggcgccaat
taccaccaggggccggagtgggtgtggcccatcggtttctacctgcgggcgcgcctgatc
ttcgccaaaaagtgtggccatttggacgagaccattgccgagacctgggccatactgcgg
gcccatctccgagagctacagacatcccattggcgcggattgcccgagttgaccaacgac
aatggctcctactgcggtgactcctgtcgcacgcaggcctggagtgttgctgccattttg
gaagtcctgtacgatctgcactccttgggagcagacgtggcctaa

DBGET integrated database retrieval system