KEGG   Drosophila sechellia: Dsec_GM16134Help
Entry
Dsec_GM16134      CDS       T01064                                 

Definition
GM16134 gene product from transcript GM16134-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dse  Drosophila sechellia
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dse00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 559 aa AA seqDB search
MKQRNRRNSKALKRLQQPDNKNQNCCLSKRCNYENIWQHFNSNATLEEIRHAAARICRDY
LTGPWKVVTPENLVVKRISGGLSNFLYYVSLPDLNDYDELEEHNKHQENVNVSEDFIEAT
ATVTNRSRGFTHDDESAAKAVGVTLMARELINNEDIADAAPSAIQAYKRQRCDSDSRDSS
SSKRLHTPKQEPHEVLLRIYGQTHGDHALESMITESVVFALLSERNYGPKLHGIFPGGRI
EQYIPARALITAELGEQRILKRVAEKMGEIHSLNIPMSKEPDWIWNCMQRWVSGLESIVN
GSVKTNPKSSVLKKQMELMRTFDYVQEMAWIRSIIEDEDYPVVFCHNDLQEGNILMRQPT
GQNERTPRESISSLRSNFDETLGDSLDGNSNISDTETHKSHCASPSPCPELDTTNDSALD
ASFIGDNEPDLIIIDFEYCAYNYRGYDLANHFIEWTFDYTNPQFPYFYHNPSNCATVQQR
RDFIVNYLKKYHEDENYNITGQELIKVDAEIQFFTMLSHLFWSLWSVINVTSAIEFGYWE
YGIARILEYQKLKAAYQAN
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgaaatcgtaggaatagtaaagcactcaaacgtctccagcagccagataat
aaaaatcaaaattgttgcttgagtaaacgttgcaactatgaaaatatctggcagcatttc
aatagcaatgccactcttgaggaaattcgacatgcggccgcccgtatttgccgagactat
ctaactgggccctggaaagtggttactccagagaatttagtggtgaagcgcataagtggc
gggttgtcaaatttcttgtattacgtaagccttcccgatttaaatgactacgatgagctg
gaggaacacaataagcatcaggaaaatgtcaacgtcagcgaagacttcatagaggccacc
gcaactgtgaccaatagaagcaggggtttcacacacgacgatgagtcggctgccaaggcg
gtgggcgtaacattgatggcgagggaattaataaataacgaggacatagctgacgcagct
cctagcgccatacaagcatacaaacgtcagcgatgcgatagtgatagtcgcgactccagt
tcttcgaaacgattgcacacccccaagcaggaaccccatgaggtccttctgcgaatctat
ggtcagacccatggtgatcacgcgctggagagcatgattaccgagtccgtggttttcgca
cttctcagtgaacggaactatgggcccaaactgcacggaatctttccgggcggacgcatt
gaacaatacattccggcgcgcgcattgatcacagcagaattgggagagcaacgaatatta
aagagagtggctgagaaaatgggtgagatccacagtctcaatatacccatgtctaaggag
cccgattggatttggaattgtatgcagcgttgggtttccggtttagagagcattgttaac
ggcagtgtcaaaacgaatccaaaatcttcggtactaaaaaaacaaatggaattgatgcgg
acttttgactacgttcaagagatggcctggattaggtcgattatcgaagatgaagattat
ccagttgtgttctgtcacaatgatctgcaagaaggtaatattctgatgcgacaaccgaca
ggccaaaacgaacggaccccccgggagtctatcagtagcctgagatcaaacttcgacgaa
actttgggtgatagccttgatggaaatagcaatatatcggatacggagacacacaaatca
cattgtgcgtcgccttcaccatgcccggagttggacactacgaatgactcagccctggat
gccagcttcataggcgataatgagccggatcttattatcatcgactttgagtattgtgcc
tacaactaccgtggctatgatcttgccaatcattttattgagtggactttcgactacacc
aacccacagttcccttacttctaccacaaccccagcaactgcgcaactgttcagcaacgg
cgcgacttcattgtaaactatttaaagaagtatcacgaagacgaaaactataatatcact
ggtcaggagttgataaaggtagacgctgagattcagttctttacaatgctgtctcatctg
ttctggagcctttggtccgtaattaatgtcacatcggcgattgagtttggttattgggaa
tatggtattgctcgaattttggaatatcaaaagctaaaggcagcttatcaagctaattaa

DBGET integrated database retrieval system