KEGG   Drosophila sechellia: Dsec_GM16134Help
Entry
Dsec_GM16134      CDS       T01064                                 

Definition
GM16134 gene product from transcript GM16134-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dse  Drosophila sechellia
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dsec_GM16134
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dsec_GM16134
    2.7.1.82  ethanolamine kinase
     Dsec_GM16134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 559 aa AA seqDB search
MKQRNRRNSKALKRLQQPDNKNQNCCLSKRCNYENIWQHFNSNATLEEIRHAAARICRDY
LTGPWKVVTPENLVVKRISGGLSNFLYYVSLPDLNDYDELEEHNKHQENVNVSEDFIEAT
ATVTNRSRGFTHDDESAAKAVGVTLMARELINNEDIADAAPSAIQAYKRQRCDSDSRDSS
SSKRLHTPKQEPHEVLLRIYGQTHGDHALESMITESVVFALLSERNYGPKLHGIFPGGRI
EQYIPARALITAELGEQRILKRVAEKMGEIHSLNIPMSKEPDWIWNCMQRWVSGLESIVN
GSVKTNPKSSVLKKQMELMRTFDYVQEMAWIRSIIEDEDYPVVFCHNDLQEGNILMRQPT
GQNERTPRESISSLRSNFDETLGDSLDGNSNISDTETHKSHCASPSPCPELDTTNDSALD
ASFIGDNEPDLIIIDFEYCAYNYRGYDLANHFIEWTFDYTNPQFPYFYHNPSNCATVQQR
RDFIVNYLKKYHEDENYNITGQELIKVDAEIQFFTMLSHLFWSLWSVINVTSAIEFGYWE
YGIARILEYQKLKAAYQAN
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgaaatcgtaggaatagtaaagcactcaaacgtctccagcagccagataat
aaaaatcaaaattgttgcttgagtaaacgttgcaactatgaaaatatctggcagcatttc
aatagcaatgccactcttgaggaaattcgacatgcggccgcccgtatttgccgagactat
ctaactgggccctggaaagtggttactccagagaatttagtggtgaagcgcataagtggc
gggttgtcaaatttcttgtattacgtaagccttcccgatttaaatgactacgatgagctg
gaggaacacaataagcatcaggaaaatgtcaacgtcagcgaagacttcatagaggccacc
gcaactgtgaccaatagaagcaggggtttcacacacgacgatgagtcggctgccaaggcg
gtgggcgtaacattgatggcgagggaattaataaataacgaggacatagctgacgcagct
cctagcgccatacaagcatacaaacgtcagcgatgcgatagtgatagtcgcgactccagt
tcttcgaaacgattgcacacccccaagcaggaaccccatgaggtccttctgcgaatctat
ggtcagacccatggtgatcacgcgctggagagcatgattaccgagtccgtggttttcgca
cttctcagtgaacggaactatgggcccaaactgcacggaatctttccgggcggacgcatt
gaacaatacattccggcgcgcgcattgatcacagcagaattgggagagcaacgaatatta
aagagagtggctgagaaaatgggtgagatccacagtctcaatatacccatgtctaaggag
cccgattggatttggaattgtatgcagcgttgggtttccggtttagagagcattgttaac
ggcagtgtcaaaacgaatccaaaatcttcggtactaaaaaaacaaatggaattgatgcgg
acttttgactacgttcaagagatggcctggattaggtcgattatcgaagatgaagattat
ccagttgtgttctgtcacaatgatctgcaagaaggtaatattctgatgcgacaaccgaca
ggccaaaacgaacggaccccccgggagtctatcagtagcctgagatcaaacttcgacgaa
actttgggtgatagccttgatggaaatagcaatatatcggatacggagacacacaaatca
cattgtgcgtcgccttcaccatgcccggagttggacactacgaatgactcagccctggat
gccagcttcataggcgataatgagccggatcttattatcatcgactttgagtattgtgcc
tacaactaccgtggctatgatcttgccaatcattttattgagtggactttcgactacacc
aacccacagttcccttacttctaccacaaccccagcaactgcgcaactgttcagcaacgg
cgcgacttcattgtaaactatttaaagaagtatcacgaagacgaaaactataatatcact
ggtcaggagttgataaaggtagacgctgagattcagttctttacaatgctgtctcatctg
ttctggagcctttggtccgtaattaatgtcacatcggcgattgagtttggttattgggaa
tatggtattgctcgaattttggaatatcaaaagctaaaggcagcttatcaagctaattaa

DBGET integrated database retrieval system