KEGG   Drosophila sechellia: Dsec_GM16217Help
Entry
Dsec_GM16217      CDS       T01064                                 

Definition
GM16217 gene product from transcript GM16217-RA
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dse  Drosophila sechellia
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dsec_GM16217
   00330 Arginine and proline metabolism
    Dsec_GM16217
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Dsec_GM16217
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Dsec_GM16217
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dsec_GM16217
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Dsec_GM16217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 341 aa AA seqDB search
MPNIAVIGAGVNGVASAIKILEHYVKDGKTPIRVTIISEDFTPNTTGDGSAGLWGPYLLG
STSQAKVYKWSKSMHQFLEQIWLSEDAGEAGVCLLPCIRLSTSTVGTVEDFWRDIVYGAV
NLSKEQLAAYNKGRSVKFTSGLSFVTYTSEPIKLLSYLMKRFTRNGGVVVRKRITDLEAF
VADSEYDVIVNCSGLGSKTLLNDDQMYAVRGQVSRVKANWIFSAMLDESDDGNYIIPNTE
SVVLGGTHQERDYNSKVCQKDRQMIVDGCRRYIPGLEHTKSLFDWVGLRPGRTQLRLEAE
RRGRKLLIHNYGHGGSGVTLCWGCADDVLDILLAAKNGSKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacattgcagttatcggtgccggggttaatggtgttgccagtgccattaagata
ctggaacactacgtgaaggatggaaagacacccataagggtgactatcatatcggaggac
ttcactccgaacaccacaggagatggttcggctggtctctggggtccctaccttctgggc
agcacttcgcaggcgaaagtctacaagtggtcgaagagcatgcaccagtttctagagcag
atctggctgagtgaggatgccggagaggctggggtctgtctactgccctgcattcggctg
agcacctcgacggtgggcacggtcgaagatttctggcgtgacattgtctatggagccgtg
aatctgtccaaggaacagctggcggcctacaataaaggtcgcagcgttaagttcacgtct
ggtttatccttcgttacctacacctcggagcccatcaagctactgtcgtatttgatgaag
cgtttcacccgcaatggaggtgttgtggtccggaaaaggattacagacctggaggcattt
gtagccgattccgagtacgatgtgatagtcaattgctccggattgggatccaagacacta
ctgaacgatgatcaaatgtacgcagtgcgtggacaagtgtcccgggtgaaggccaattgg
attttctctgccatgctggatgagagtgatgatggcaactatattatacccaacaccgag
agtgttgtcctgggcggaacccatcaggagcgggactacaactctaaggtatgccagaag
gacaggcagatgatcgtggatggctgccggcggtacattccgggtttggagcacacaaag
agcctcttcgattgggttggcctgcggccgggtcgcacccaactccgactggaagccgag
cgccgtggccgcaagctcctcatccacaactatggtcatggcggcagtggagtcactttg
tgctggggctgtgccgacgatgtcctcgatatcctgttggccgccaagaacggttccaaa
ttataa

DBGET integrated database retrieval system