KEGG   Drosophila sechellia: Dsec_GM16309Help
Entry
Dsec_GM16309      CDS       T01064                                 

Definition
GM16309 gene product from transcript GM16309-RA
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
dse  Drosophila sechellia
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dse00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1418 aa AA seqDB search
MKLSTDAHSEIEGDAAHGNVLCNSASDSLAATDEVAAGNDESAATEGDDVEIPMDTNNST
PVRLLDKSGQDPGQNGAEPAGEESDLESKQQTPVQKKQQQRVSMVNRKRDLINLQSALSP
KYIGYANANSPTPLSDSDDTIRTTRRRVNQAAALNNNSSAGDTLAHDNASPRTPGGGGGG
GDDSANQLPSKTYMSPIEKLLIKNGASSPNSTGFETGSEDLVIRPLVRKHVKRKIKRVSK
AKVSLELEEENQQGVDEKSVKTEPIDEEVDQAAEEAPNQVAETTAISIKPETEAEHKAAV
DVHIKQEDTISLDIVRNPVESTFMVITEEPKELEKSTSSTEVDLKSPPDLSSTALATSIK
SPSSVSIDSAKGLSIVTDPGWPIYQAGDLFWGKVFSYCFWPCMVCPDPLGQIVGNMPSHA
QRSFLDNANVPIQVHVRFFADNGRRNWIKTENLLTFAGLKAFEDMREELRIKHGPKSAKY
RQMVPKRTKVVIWRQAIEEAQAMTQIPYSDRLEKFYQTYENVVTPNRQKRNRTKYMMQDT
SDVGSSLYDSTDNLHNKQGTQLLAVKRERSESPFSPAFSPIKRKNEKRAKRRKLSNGTEA
DTGSNSLAEILSQTITTVDSSVSENPEFRQLLSAIMEYVMMNRSDEKVESLLVSVVSNIW
TLRQLQLRELERDLFSGKIDEPLGSSVVGRGSGVGTVKRLSNRLMTLMVRRSMTPVVTPS
TTPAPSEPDRRLSEAPKSKKPVNRPIEEVIEDILQLDSKYLFRGLSRDPICKYCYQAGSD
LVRCSRTCSSWLHADCLERKETGAPMPKIGSRKALVISPTSKSPSPDEEHVTADAKEVGA
VGTSLVCHECNVGEPEGCVICHQVESPAVPSTPRKEDAPSHTPIEDKLLTCSQPVCGKRF
HTSCCKYWPQASSSKHSARCPRHVCHTCVSNDPSGRFQQLGSSKLAKCVRCPATYHQDSH
CIPAGTQMLNATNIICPRHNIAKADAHVNVLWCYICVKGGELVCCETCPIAVHAHCRNIP
IKTNENYICEECESGRLPLYGEIVWAKFNNFRWWPAIILPPTEVPSNILKKAHGENDFVV
RFFGTHDHGWISRRRVYLYIEGDTGDGHKTKSQLFRNYTTGVEEASRFLTIIKARRQEQA
MGRQSGIKLHPPPYVKIKTNKAVPPLRFSQNLEDLSTCNCLPVDEHPCGPEAGCLNRMLF
NECNPEYCKAGSLCENRMFEQRKSPRLEVVYMNERGFGLVNREPIAAGDFVIEYVGEVIN
HAEFQRRMEQKQRDRDENYYFLGVEKDFIIDAGPKGNLARFMNHSCEPNCETQKWTVNCI
HRVGIFAIKDIPVNTELTFNYLWDDLMNNSKKACFCGAKRCSGEIGGKLKDDAIKAHAKL
KQMRRAKAPTVRIHVKPKKTPKVKHISADDEPMDAKDE
NT seq 4257 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgagcacggacgcgcactctgagatcgagggcgacgctgcccacggcaatgtc
ctgtgcaactccgcgtccgattccctggccgccaccgacgaagtggctgcgggcaacgac
gagtcggcggccaccgaaggcgatgatgttgaaataccgatggacaccaacaacagtact
ccggttcgactgctggacaagtccggccaagaccccggccagaacggcgcagagcccgct
ggggaggagtccgacctggagagtaagcagcagacgccagtccaaaaaaagcaacaacag
cgtgtgtccatggtgaacaggaaacgagatcttatcaacttgcagtcggcgctgagcccc
aaatatattggctatgccaatgccaactcacccacgccgctttccgattccgatgacaca
atacgcacgacgaggcgacgcgttaaccaagcggcggcactgaacaacaacagcagtgct
ggcgacaccctggcccatgataatgcgtcaccaaggacccccgggggaggaggaggtggt
ggagacgatagcgctaatcagctgcccagcaagacctacatgagccctatcgaaaagctg
ctaatcaagaacggcgccagttcgcccaacagcaccggtttcgagacgggctccgaggac
ctggtcatacggccactcgttcgcaaacacgtaaagcgcaaaattaagagagtgtcgaag
gcgaaagtgtccctcgaactggaggaggaaaaccagcaaggggttgacgaaaagtcagtg
aaaacggagccaatagatgaggaagttgaccaggcagcagaagaagccccaaatcaagtg
gctgaaactaccgcgatctccattaaaccagagactgaggctgagcacaaagcagccgta
gatgttcatataaagcaagaggatactatcagcttagatatagttaggaatccagtagag
agcactttcatggttatcactgaagagccgaaagaactggaaaaaagtacctcctccacg
gaggtggatctgaaatctccacccgacttgagctccacggcactcgccacatccatcaaa
tccccctcctctgtgagcatcgatagcgccaaaggcctgtccatagtcactgatcccggt
tggcccatctaccaagctggtgatctgttttggggcaaggtcttctcgtactgcttctgg
ccctgcatggtgtgtccggatccgcttggccagattgtgggcaacatgccgagccatgct
cagcgctcattccttgacaacgccaacgttcccattcaagtgcatgtgcgcttcttcgcc
gacaacggacgccgcaactggattaagacggagaatctgctgacctttgccggactgaag
gctttcgaagatatgcgcgaggaattgcgaatcaagcatggaccgaagagcgccaagtac
cgtcagatggtgcccaagcggacaaaggttgtcatctggcgacaggccatcgaagaggcg
caagctatgacccagatcccgtactccgatcgcctcgaaaaattctaccagacgtacgag
aacgttgtcactcccaatagacaaaaacgcaaccgtaccaagtatatgatgcaggacact
tctgacgtgggcagcagcctgtacgactccacggacaacctgcacaacaagcaaggcaca
cagttgctggccgtgaagcgagaacgctcggagtcgccctttagtccggccttctccccc
ataaagaggaagaacgaaaagcgggccaagcgccgcaaactgagcaatggcaccgaagcg
gatactggtagcaacagcttggcggaaattctttcacagaccataacaactgttgacagc
tccgtttctgagaatcccgagttcagacagctcttgtctgccatcatggaatatgtaatg
atgaaccggtcagatgaaaaagtagagagccttctggtctccgtggtcagcaatatctgg
accctgaggcaactccagttgcgcgagctagagcgcgacttgttcagcgggaaaattgac
gagcctttgggctcgtcggtggttggtcgtggcagcggtgttggcactgtcaagcgactc
tcgaatcgccttatgaccttgatggtgcgccgtagcatgactcctgtagtgacaccaagt
acaacgcccgcaccatcggagccagatcgtcgcctttccgaggcgccgaagtccaagaag
cccgtcaaccggcccatcgaggaagtaattgaagacatcttgcagctggacagcaagtat
ctcttccgtgggcttagccgcgatcccatatgcaaatattgttaccaggcgggatccgat
cttgtgcgctgctcgcgcacctgctcgagctggctgcatgccgactgcctggaacgaaag
gagacaggagctccgatgcccaaaataggcagtcgaaaggctctggtcatttcacccaca
tcgaaatctcccagtcccgatgaggagcatgtaacagccgacgccaaggaagttggtgcc
gttggtacctcactggtgtgccatgagtgcaatgtgggcgaaccggaaggctgtgtcatt
tgccaccaagttgaatcgccagctgttcccagcactccccggaaggaggatgcaccatcg
cacacgccaatcgaagataagctcctgacatgcagccagcctgtgtgtggcaagcggttt
cacacgagttgctgcaaatattggccgcaggcgagcagcagcaaacattcggcacgttgc
ccacggcacgtgtgccacacatgcgtctccaacgatcccagcggcaggttccagcagctg
ggcagctccaaactggccaagtgcgttcgctgcccggccacctatcaccaggactcgcat
tgcattccagccggcacccagatgctcaacgccaccaacataatctgtccgcggcacaac
atcgccaaggccgatgcccacgtcaatgttctgtggtgctacatctgcgtcaaaggcggc
gaattggtatgctgcgaaacgtgccccattgctgtgcacgcccactgccggaatattccc
atcaagaccaacgagaactacatctgcgaggagtgcgagagcggtcgtctgccgctgtac
ggcgagatagtgtgggcgaagttcaacaacttccgctggtggccggccatcatcctgccg
cccactgaggtgcccagcaatatacttaagaaggctcacggcgaaaatgactttgtggtg
cgattctttggcacacacgatcatggttggatttcgcgacgtcgcgtttacctctacatc
gagggggatacgggcgatggacataagaccaagtcgcagctgtttcgtaactacacgacc
ggcgtggaagaggcgtcgcgcttccttacgatcattaaagcccgccggcaggaacaggcc
atgggacgccagagtggtattaagctccatccgcctccatatgtgaaaatcaagaccaac
aaggcggtgccaccgttgcgattctcgcagaatctagaggatttgagtacttgtaactgc
ctgccggtggacgagcatccctgtggcccggaggctggctgcctcaaccgcatgctgttc
aatgaatgcaatccggaatactgcaaggctggcagtctttgcgagaatcgaatgtttgag
caacgcaagtcgccacgtctggaggtggtctacatgaacgagcggggatttgggctcgtc
aaccgtgagcccatagccgcgggcgactttgtcatcgagtacgtgggcgaggtgatcaat
catgccgagttccagcggcgcatggagcagaagcagcgggatcgcgacgagaactactac
ttcttgggcgtggaaaaggactttataatcgatgcgggaccgaagggcaacttggctcgc
ttcatgaaccattcgtgcgagcccaactgcgagacccagaagtggaccgtcaattgcatc
catcgtgtgggcatatttgcaatcaaagacattccagtgaacacggagctcaccttcaac
tacttgtgggacgacttaatgaacaacagtaagaaggcctgcttctgcggagcaaagcgc
tgttccggcgagatcggcggcaaactcaaggatgatgcaattaaggcccatgccaagttg
aagcagatgcgacgggcaaaagcacccaccgttcgtatccatgtgaagcccaagaagact
cccaaggtgaaacacataagtgcggacgatgagccaatggatgcgaaggacgagtaa

DBGET integrated database retrieval system