KEGG   Drosophila sechellia: Dsec_GM16452Help
Entry
Dsec_GM16452      CDS       T01064                                 

Definition
GM16452 gene product from transcript GM16452-RA
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsec_GM16452
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsec_GM16452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2740 aa AA seqDB search
MTFDTRRHTTGQPGSTAPSSSSSTTSTATTTTSPAQSAGSGSGIGTGTGTVANSSLPGGG
TGSLDGNQDQQPATGNQSSDDVAASLSANSVDSTITIVPPEKLISSFPTTKLRLLMQKIS
NPRWVVPVLPEQELEVLLNAAIELAQAGVDHDCEPCVEFYRHGLSTSFTKILTDEAVNSW
KNNIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIVFDPENKFNTFNAARQPECFAAPD
YIWGQLDSNKMYARPPPEPKNARGWLVDLINRFGQLGGFDNLLERFNTGLELLKRNQNKC
TGKNVGVEGSVENGAQDNRLTLALIHSLLRPFGQCYELLMPATIAKYFMPTWNVVLDLLD
SFTDEELKREVKPEGRNDYINGIVKSARLLASRLTGQEELIRDLEMFRLKMILRLLQVSS
FNGKMNALNEINKVLYSVAYFSHRSQPVPHYMPEDEMDWLTAERMAQWIKSSDVLGVVLK
DSLHQPQYVEKLEKIIRFLIKQQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWDFT
PEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQEVP
PEVLDQALGAHVKILDYSCSDERDAQRTIWLDKCVDELKSGDGWVLPALRLIRDICCLYD
TTTNHAQRAQTSTIRQQVIERLQNDYSLVILVTNSLTAYMEKVRQMVTDSPGLEANRIII
DGRFPHHVQIAERLEFLKFLLKDGQLWLCADQAKQIWHCLAVNAVFPADREECFRWFGKL
MGEEPDLDPGINKDFFENNILQLDPHLLTESGIKCFERFFKAVNSKEDKLKAIHRGYILD
NEDLIGKDYLWRVITTGGEEIASKAIDLLKEVSTALGPRLQENIAEFHEMFIGECCSRLR
THYGNIVILGKTQLQEELDAPDQSDNANDESKDSKMRFIEAEKMCRILKVLQEYVKECDR
SFSGDRNPGRSIDDMEIVTHSNETMAAFKRSLLKRIKGTSTTNIKVDLLYANGEMIGVSD
EINPLYQYTIRDKMNLTAKLTPVGTGLASSPDSSSDSSTGSPPRPCPDMQRVESESTLPG
VIISQNYQYTEFFLKLYQLGSDLEHGRLRDSAKVLLHLLPCDRQTMRQLKMMCKVPRAAV
TVAATGNKIAKDEEEKLYPTEQSGIEAEEEHCTPEQMFLHPTPAQVLYNLSVLHGLLIPA
LDPLGESALLVQSAWMHSGCAHFVLELLTKNNFLPSADMHTKRASFQCVLRLAKLFLYIV
GSVLSRVGDEPMICDLDNGSRSQVDILKQNFPTMPNSSQGTLRAISAKLAVMLAREMLSA
SPEGDRCRTLFSSTLEWSCPDISTIKAVVQLAWASSCGNLQALGSSSGDFEDEVIVPDGQ
DFSMCKEALEVLTISFILNPSANEALTSDPNWPKFITSIVLKNPLRHVRQVASEQLFLAS
TYCAGDRRPFVYMVNLLVGALKTLVPQYESTCAEFFSVLCRTLSYGCIYNWPLQISEGLL
GDEIKWLQRIRENVHATGDTQVHEELLEGHLCLAKELMFFLAADSKAQLNELIHELIDDF
LFKASREFLHLRRHGSLRQDTVPPPVCRSPHTIAAACDLLIALCQLCVPNMKLLTNTLID
FVCTDTDPLREWDYLPPVGARPTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHG
AATTDGEDFSGDSDLTGGGLGPALFSGPASALVTLSSSSTTTEDGLHDVRKNYHVVILKH
VQAIFAHLGHSALQFYVPRGLWTHFKLQGEPVNLREQQDAVEFFMSLLESLDEGLKALGQ
PQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGA
DAYHCDKCDKKVVTVKRLCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEP
YTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKC
QWYKFDDGEVTECKMHEDEEMKVECFGGEYMGETYDNNLKRMQYRRQKRWWNAYMLFYTR
CDQTPVQYEPSVEQLSLSESRNMVLPLPKPIERSVRHQNIRFLHSRSIFSVEFFNFIKKL
VSCNIPSTRSNKITPAAEELSLLGVQLASQFLFHTGFRTKKSLRGPVMEWYDALSQHIRS
SALVRKWFANHALLSPPSRLGEYILMAPSPDVRTVFVKLVVFFCHFAINDEPLTGYDGAN
LCEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYVGLGTREKQQLLRLNVPLQFIQVALD
DGPGPAIKYQYPEFSKLHQVVSHLIRCSDVSEKCQSSNQNARPLPNPFKDPTVAHEELTP
LSTECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWENPHFSRAVLTELLWQCGFAYC
HDMRHHTDLLLNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIKC
LTQLFHKSPIALQMLHTNTNITRHWSIAVEWLQDELDRQRGIGCQYNSYSWSPPAQSNDN
TNGYMLERSLSAKNTWSMAFELCPDEVSEKTDENNEPNLETNIDENKSEPVAQPGAVLEG
STGGTEQLAENKTPTTSSPSTAAWPARGDSDAIPRLSRQLFGIHISTGSGSTSGGTAPNS
ALTTAGSATNSETESSTQETTGETTINGLTNSLDQMEITAKKGVRSRSKGGKLPPVLFHH
HQLPPEQQLKLKQQQQQQQQQQQQQQLRGDINKSSSSRLI
NT seq 8223 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgacacgcgtaggcacaccaccggacagccgggaagcacagcgcccagctca
agcagcagcaccaccagcacagcaaccaccacaacaagtccggcgcagagtgccggatca
ggatcgggcataggaacaggcacgggaacagtcgccaactcgagtctgccaggaggaggg
acaggtagcttggacggcaaccaggatcaacagccggccacaggcaatcagagctctgat
gacgtagccgcttccttgtcagcgaacagcgtggacagcaccatcacaattgtgcctcca
gagaagcttatttcctcgtttcccacgacgaaactgagattactaatgcaaaagatatcc
aatccgcgttgggtggtgcccgtgctgcctgaacaggaattggaggttctcttaaatgca
gccatcgaactggcccaggctggtgtggatcacgactgcgagccatgtgtggagttttat
cgccatggactgagcacttcatttaccaagatcctaaccgacgaggcggtgaattcgtgg
aagaataacatccaccactgtattcttgtgtcttgcggaaagcttttacatctaatcgcc
atccacatgcagcgagacaatccctatctacttgacttgcttgctattgtttttgatccg
gagaacaagttcaacacattcaacgcagcccgtcaaccggagtgtttcgcagcgccggac
tacatctggggtcagttggacagcaacaagatgtacgctcgtcctcctccagagcccaaa
aatgcgcgtggctggcttgtggatctcattaaccgcttcggacagttgggaggctttgac
aatctactggaacggtttaataccggactggaactgctgaagcgcaaccaaaacaagtgc
actggcaagaatgttggtgtcgagggtagtgttgaaaatggggctcaggataatcgcctc
acccttgccctcatacatagcctcttgcgtccattcggtcaatgttatgagcttctaatg
cctgccaccatagccaagtactttatgcccacctggaacgtcgtgttagaccttctggac
agcttcacagacgaggagttaaagcgagaagtgaaacccgagggacgcaatgactacatc
aacgggattgtaaagtcagcccgcttactggccagccgcttgactggccaggaggagcta
atccgagatctggagatgtttcgcctaaagatgatcctgcgtctgctgcaggtgtccagc
ttcaacggcaagatgaatgcccttaatgagatcaacaaggtgctctactcggtggcatat
ttctcccatcgatcacaacccgtgccccactatatgcccgaagacgaaatggactggctg
acggcggagcgcatggcgcaatggataaagtcgtcagatgtattgggtgtcgtactcaag
gactcgctacaccaaccgcagtatgtggaaaaattggagaagatcatccgctttcttatt
aaacagcaggcactaacgttggatgatttggatgcagtttggagagcgcaggcaggcaag
cacgaggcaatcgtgaagaacgttcacgatctactggcgaaacttgcatgggactttact
cccgagcaactggatcacctcttcgaggcgttccaggccagtatgaccactgccaataag
cggcaacgggaaagacttcttgagctaatacgccgcttggctgaggatgacaaaaatggt
gtgatggcccaaaaggtgcttaagctgttttggactctggcccacagtcaggaggtgccg
ccagaggtgctcgatcaggcgctgggcgcacacgttaaaatcttggactacagctgctcg
gacgagcgggatgcccaaagaaccatttggttggataagtgcgttgacgaactaaagtca
ggcgatggatgggttctgcccgccttgcgtctaatccgggatatttgttgcctatatgat
accacgacgaatcatgcccagcgcgctcaaacgagtacgattcgtcagcaggtgattgaa
cgactacagaatgattattccttggtcattctggtcaccaatagtttgactgcatacatg
gaaaaggtacgccaaatggtaaccgactcaccgggcctggaagcaaacagaatcataatt
gacggaagatttccgcaccatgtgcaaatagcggagcgactggagttccttaagttcctg
ctgaaagatggacagctatggctgtgcgcagatcaggcaaagcagatttggcattgcttg
gcggtcaatgcagtttttccggcagatcgtgaggagtgttttagatggtttggcaagttg
atgggtgaggagcctgacttggatcctggcataaacaaagacttcttcgagaacaacatt
ctacaacttgatccgcatctgctaaccgaaagcggaatcaagtgctttgagcgcttcttc
aaggccgtcaactccaaagaggacaagcttaaggcgatacatagaggttacatactggac
aacgaggatctaataggcaaggactacttgtggcgggtcatcacaactggaggcgaggaa
atcgccagcaaggccattgatctacttaaggaagtgtcgacggcattggggccacgtctg
caggagaatatcgctgagtttcatgaaatgttcattggtgagtgctgctcccgcctgcgc
acacactatggaaacatcgttattttgggcaagacccagctgcaagaggaattggatgca
cccgatcagtcggataatgccaacgacgagtctaaagattcaaaaatgcgtttcatcgag
gcggaaaagatgtgccgaattttaaaggtgctgcaagaatacgtgaaggagtgtgatcgt
tccttcagcggcgatcgtaaccctggcagatctatcgacgacatggagatcgttacacac
agcaacgagacgatggccgcttttaagagaagtctacttaagcgaatcaagggaacttcg
acgaccaacattaaggttgatctcctgtatgcaaatggggagatgatcggagtttccgat
gaaattaacccactttatcagtacactatccgggataagatgaatcttacagcaaaactc
acgcccgtgggtacgggtctagccagcagtcccgactcctcgagcgactcgagcacagga
tctcctccgcgtccctgccctgacatgcagcgtgtggagtcagaaagcacgctacccggc
gtgatcatctcgcaaaactaccagtacacagagttctttctaaaactgtaccaactgggc
agtgatctcgagcacggtcgtcttcgagacagtgcaaaagtattactgcacttgctaccc
tgcgaccgccagacgatgcgtcagctaaagatgatgtgcaaggtgccgagggctgccgta
acggtggctgcgacgggtaacaagattgctaaggatgaggaggagaaactttaccccact
gagcagtcggggattgaagctgaagaggaacactgcactccagagcaaatgtttttgcac
cccacgcctgctcaagtgctatacaacctcagtgtgttgcacggactgctgattcccgcg
ctagatccactaggagaaagtgccctactagtgcagtctgcatggatgcattctggctgc
gctcattttgtgctggaactgttgaccaaaaacaattttctgcccagcgccgatatgcac
acaaagcgtgcttccttccagtgtgtgttgaggttggcaaagctgttcctgtacatagtt
ggcagtgtattgtctcgtgtaggtgatgaacccatgatctgcgaccttgacaacggatcc
cgttcccaggttgacatcctaaagcagaatttcccgacgatgcccaatagctcacaggga
acattgcgggcgatctccgcgaaactggctgtgatgcttgcccgcgagatgctttcagcc
agcccagaaggtgatcggtgccgaacgctatttagctccacactggagtggtcatgtccc
gacatttcaaccattaaggcggtggtgcaactggcctgggcctcgtcttgcggaaatctt
caggctctaggtagcagtagcggcgactttgaagatgaggtgatcgtgccggacgggcaa
gactttagcatgtgcaaggaggcgctagaggttctcaccatttcgtttattctgaatccg
agtgccaacgaggcgttgaccagcgatccgaactggccaaagttcatcacctctattgtt
ctgaagaacccgcttcgtcacgtgcggcaggtggcctctgagcagttgtttctggcttct
acctattgcgccggggatcggcgaccgttcgtatacatggttaacttgctggttggcgcg
ttgaagacgctggttccccagtacgagtcaacttgcgctgagttcttttcggtactgtgt
cgaaccctttcttatggatgcatctacaactggccgctgcagattagcgagggattgtta
ggcgatgagattaagtggctgcaacggattcgcgaaaacgtccacgccaccggcgacaca
caagtgcacgaggagctccttgaaggccacctctgccttgccaaagagctaatgtttttc
cttgccgccgattcaaaggcgcagctaaacgagctcatccacgaactgatcgacgacttc
cttttcaaggcctctcgcgaatttctgcatttacggcgtcatggcagtctacggcaggac
accgtcccgccaccggtttgtcgaagtccgcacacaatcgccgctgcttgcgatctcctc
attgccttgtgccagctctgtgttcctaatatgaagctactcaccaatacactcatagac
ttcgtctgcacggatactgatccgttgcgcgaatgggattacctgccgcccgtgggcgcc
aggccaaccaaaggtttctgcggactaaagaacgccggtgccacctgctacatgaattcg
gtgttgcagcagctttacatggtgccagcggtccgggtgggtattctgcgagcccacggc
gctgccaccaccgacggcgaggatttcagtggcgattccgatttgacgggaggcggtctt
ggaccggccctgttctcgggtcccgcttctgccctagtcaccctctcctcgtcgtcgacg
actaccgaagacggtttgcacgatgtgcgaaagaactatcacgttgtgatcctgaagcat
gtgcaggccatattcgcccacctgggccacagtgcgttgcagttttacgttccacgtggt
ctctggacgcattttaaactgcagggagagcctgtgaatcttcgcgagcaacaggatgcc
gtggagttcttcatgtccttgttggaaagtctcgatgaaggacttaaggcgctaggccag
ccccagcttatgaatgccactctgggcggttcgttcagcgaccagaaaatctgccaagag
tgtccccatcgctactccaaagaggaaccatttagtgtatttagtgtcgatattaggaat
catagctcattaaccgaatctctggagcagtatgtcaagggagagctgctcgagggagcc
gatgcataccattgtgataaatgtgataaaaaagtagttaccgttaagcgtctgtgcgtt
aagaagctgccacccgtgttagccattcaactaaagcgcttcgaatacgactacgaacgc
gtctgtgcgattaaatttaatgattattttgaatttccacgtatcttggatatggaacca
tacacagtgtctggcctagctaagctagagggcgaggtggtggaagtgggtgataattgt
caaacaaacgttgagacgacaaagtacgaactgaccggcattgtggtgcacagcggacag
gcctccggcggtcactacttcagttacattctctccaaaaacccagcgaacggcaagtgt
cagtggtataagtttgacgacggtgaagtcaccgagtgcaagatgcacgaggacgaggaa
atgaaggtagagtgctttggcggcgaatacatgggggaaacctacgataacaatctgaag
cgcatgcagtaccgtcggcagaagcgctggtggaatgcttatatgttgttctacacccgc
tgtgatcaaacacccgtgcagtatgaacccagcgtggagcagttgtcactctcagaaagt
cgaaacatggttttaccattgccaaagcccattgagcgcagcgtgcggcaccagaacatt
cggtttctccactcccgcagcattttttccgtggagttcttcaacttcatcaaaaagttg
gtcagctgcaatataccctctactcggagcaataagatcactcctgctgcagaggagctt
tcactgctgggtgtgcaattagcatcgcagtttcttttccacaccggcttccgcacgaaa
aagtctctgcgagggcccgttatggaatggtatgacgcgctatcacaacacatacgttcc
tcggcactagttcgcaagtggttcgctaatcatgcgcttctctcgccgccatcacgtttg
ggcgagtacattctgatggctccgtctccggatgtccgtaccgtctttgtcaagttggtg
gttttcttctgccattttgccatcaacgatgaacctctgactggctacgacggcgctaat
ctctgcgagcaggtactcatcagcgtgctgcgtctcttgaaatccgaggcagccgactat
ggcaaacacctgccccactattttagccttttcagtatgtacgtgggactaggaacacgg
gaaaaacagcaactgcttaggctcaatgtgccgctgcaatttattcaggtggcgttggac
gatggccccggcccggcaataaaataccagtatccagagttcagcaagctacaccaagtg
gtttctcacctaatacgctgcagcgatgtaagcgaaaaatgtcagagctccaaccagaac
gcccgtccactgcccaatccgttcaaagatcccactgttgcgcacgaggagctgacgccc
ctttccactgagtgcatggacttgctatttaatcgcacgggctacatcaagaaagtgatc
gaagacactaacgtgggcgacgagggtctgaagctgttacaatactgtagctgggagaat
ccacatttctctcgcgcagtgctaaccgaattgttgtggcagtgtggtttcgcctattgt
cacgacatgcgtcaccacactgatctgctcctgaacatcctgctgatcgacgactcgtgg
cagcaccatcgcatacacaatgctctcaacggagtggcggaggagcgtgagggtctctta
gagacgatacagcgggcaaagacgcactaccagaagagggcgtaccaaataatcaagtgc
ctgacgcaacttttccacaagtcgccgattgcgctgcagatgctccacacaaatacgaac
attacccggcactggagcattgcagtcgagtggctgcaagacgaactagatcggcagcgg
ggcatcggttgtcagtacaattcatactcgtggtcgccgccggcgcagagcaacgacaac
actaatggctacatgctagagcgatcgctgtctgccaagaacacgtggtccatggctttc
gagctctgtccagatgaggtcagcgaaaaaacggatgaaaataatgagccgaacttggag
accaacatagatgagaacaaatcggaaccggtggctcagccaggagccgttcttgaggga
tctaccggcggcacagagcagttggctgaaaacaagacaccaaccacaagcagcccgtcc
actgccgcctggccagcgcgtggggatagcgacgccattccacgcctttctcgtcagcta
tttggaattcacatttcgactggcagtggctccactagtggaggtaccgcgccaaattcc
gccttgacaacggcgggtagtgcgactaacagcgaaacagaaagcagcacccaggagaca
accggcgagacgaccattaacggtctgacaaacagcctggaccaaatggagataacggcc
aaaaagggggtgcgaagtcgctccaaaggaggcaagctcccgccggtgctgtttcaccat
caccaattgccgccagagcaacaactcaaactgaagcagcaacaacagcagcagcagcaa
caacaacagcagcagcaactacgtggtgatataaacaagagttcctcaagccgcttaatt
tga

DBGET integrated database retrieval system