KEGG   Drosophila sechellia: Dsec_GM16455Help
Entry
Dsec_GM16455      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM16455-PA
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dse  Drosophila sechellia
Pathway
dse00010  Glycolysis / Gluconeogenesis
dse00020  Citrate cycle (TCA cycle)
dse00620  Pyruvate metabolism
dse01100  Metabolic pathways
dse01200  Carbon metabolism
Module
dse_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM16455
   00020 Citrate cycle (TCA cycle)
    Dsec_GM16455
   00620 Pyruvate metabolism
    Dsec_GM16455
Enzymes [BR:dse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dsec_GM16455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl DUF3614 TraK Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 6611530
NCBI-ProteinID: XP_002036069
FlyBase: FBgn0171370
UniProt: B4HY62
AA seq 494 aa AA seqDB search
MLRSLATTRNELGALRSVLLRSNNATYVRRSTGNVVVRALSSQLINSRNLQSIRSKLNTS
QSPVTWSYNFARAYANLPEHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGFLAKILIQGGTKDVPVGQLLCIIVPDQGSVAAFANFKDDGAAAAPAAP
AAAPAPAPAAAAAPPPPPAAAPVAAAPPPAPAAAPAAAGTGRVYASPMAKRLAEAQQLRL
QGQKPAAKPAAAAPAKAPKAAGTRYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQVD
KLLKFRAKVNKKYEKQGARVSVNDFIIKAVAIASLRVPEANSAWMDTVIRKYDDVDVSVA
VSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEFQGGTISVSNLGMFGVN
QFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNMLTVTLSADHRVVDGAVAARWLQ
HFRDYMEDPSNMVL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacaacacgaaacgaacttggggcccttcgctccgtgctcctg
cgatcgaataacgccacctatgtccgccgatcgacgggaaatgtggtagtgcgcgccctc
agcagccagctgatcaactcccggaatctccagagcatcaggtcgaaacttaacactagc
cagtcaccggtcacatggagctacaacttcgcccgtgcctatgcaaaccttccggaacac
atcagggtgccactgcccgcgctttcacccactatggagcgcggatcgattgtcagctgg
gagaagaaggagggcgacaagctcaacgaaggtgacttgctgtgcgagattgagacggac
aaggccaccatgggcttcgaaacgcctgaggagggctttctggcaaagattctcatccag
ggcggcaccaaggacgttcccgtgggccagctgctgtgcattatcgtgccggaccaaggc
agcgtagctgccttcgcaaacttcaaggacgacggtgccgccgcagcaccagctgcaccg
gcagcagctccagctccagcacccgcagcagcagcagcaccgccaccaccacccgccgca
gctccagttgccgctgcgcccccaccagctcccgctgctgctccagctgcagcaggtacg
ggccgtgtgtatgccagtcccatggccaagcgactagccgaggcacaacagctgcgtcta
caaggccagaaaccagcagccaagccagctgctgcggcacctgccaaggcacccaaggca
gctggaacgcgctacgaggacatcccggtgaccaacatgcgcgcagtgattgccaaacgc
ctgctggagtcaaagacccaactgcctcactactacgtcactgtgcaatgccaagtggat
aagctcctgaagttccgcgcgaaggtgaacaagaagtacgagaagcagggtgcccgcgtc
tctgtgaacgacttcattatcaaggccgtggccatcgccagtcttagggttcccgaagcg
aactccgcctggatggacactgtaatccgcaagtacgacgacgtcgacgtttctgttgct
gtctccacagataagggtctgattaccccgattgtcttcaatgccgaccgcaagggagtc
ctggagatctccaaggatgtcaaggctctggcagccaaggcgcgcgacaacaaactgcag
ccccacgaattccagggtggcaccatctcggtttctaatctgggcatgttcggtgtgaac
cagtttgccgctgtcatcaaccctcctcaatcgtgcatccttgccattggcaccacaacg
aagcagttggttgctgatcccgacagtctgaagggcttcaaggaggtcaacatgctgacg
gtcaccctgagtgctgatcatcgtgttgtggatggtgctgttgctgccaggtggctgcaa
cacttccgcgactacatggaggatccttccaatatggtattgtaa

DBGET integrated database retrieval system