KEGG   Drosophila sechellia: Dsec_GM16455Help
Entry
Dsec_GM16455      CDS       T01064                                 

Definition
GM16455 gene product from transcript GM16455-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dse  Drosophila sechellia
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dse01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dse00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dse00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dse00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 494 aa AA seqDB search
MLRSLATTRNELGALRSVLLRSNNATYVRRSTGNVVVRALSSQLINSRNLQSIRSKLNTS
QSPVTWSYNFARAYANLPEHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGFLAKILIQGGTKDVPVGQLLCIIVPDQGSVAAFANFKDDGAAAAPAAP
AAAPAPAPAAAAAPPPPPAAAPVAAAPPPAPAAAPAAAGTGRVYASPMAKRLAEAQQLRL
QGQKPAAKPAAAAPAKAPKAAGTRYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQVD
KLLKFRAKVNKKYEKQGARVSVNDFIIKAVAIASLRVPEANSAWMDTVIRKYDDVDVSVA
VSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEFQGGTISVSNLGMFGVN
QFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNMLTVTLSADHRVVDGAVAARWLQ
HFRDYMEDPSNMVL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacaacacgaaacgaacttggggcccttcgctccgtgctcctg
cgatcgaataacgccacctatgtccgccgatcgacgggaaatgtggtagtgcgcgccctc
agcagccagctgatcaactcccggaatctccagagcatcaggtcgaaacttaacactagc
cagtcaccggtcacatggagctacaacttcgcccgtgcctatgcaaaccttccggaacac
atcagggtgccactgcccgcgctttcacccactatggagcgcggatcgattgtcagctgg
gagaagaaggagggcgacaagctcaacgaaggtgacttgctgtgcgagattgagacggac
aaggccaccatgggcttcgaaacgcctgaggagggctttctggcaaagattctcatccag
ggcggcaccaaggacgttcccgtgggccagctgctgtgcattatcgtgccggaccaaggc
agcgtagctgccttcgcaaacttcaaggacgacggtgccgccgcagcaccagctgcaccg
gcagcagctccagctccagcacccgcagcagcagcagcaccgccaccaccacccgccgca
gctccagttgccgctgcgcccccaccagctcccgctgctgctccagctgcagcaggtacg
ggccgtgtgtatgccagtcccatggccaagcgactagccgaggcacaacagctgcgtcta
caaggccagaaaccagcagccaagccagctgctgcggcacctgccaaggcacccaaggca
gctggaacgcgctacgaggacatcccggtgaccaacatgcgcgcagtgattgccaaacgc
ctgctggagtcaaagacccaactgcctcactactacgtcactgtgcaatgccaagtggat
aagctcctgaagttccgcgcgaaggtgaacaagaagtacgagaagcagggtgcccgcgtc
tctgtgaacgacttcattatcaaggccgtggccatcgccagtcttagggttcccgaagcg
aactccgcctggatggacactgtaatccgcaagtacgacgacgtcgacgtttctgttgct
gtctccacagataagggtctgattaccccgattgtcttcaatgccgaccgcaagggagtc
ctggagatctccaaggatgtcaaggctctggcagccaaggcgcgcgacaacaaactgcag
ccccacgaattccagggtggcaccatctcggtttctaatctgggcatgttcggtgtgaac
cagtttgccgctgtcatcaaccctcctcaatcgtgcatccttgccattggcaccacaacg
aagcagttggttgctgatcccgacagtctgaagggcttcaaggaggtcaacatgctgacg
gtcaccctgagtgctgatcatcgtgttgtggatggtgctgttgctgccaggtggctgcaa
cacttccgcgactacatggaggatccttccaatatggtattgtaa

DBGET integrated database retrieval system