KEGG   Drosophila sechellia: Dsec_GM16932Help
Entry
Dsec_GM16932      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM16932-PA
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dse  Drosophila sechellia
Pathway
dse04013  MAPK signaling pathway - fly
dse04068  FoxO signaling pathway
dse04140  Autophagy - animal
dse04150  mTOR signaling pathway
dse04214  Apoptosis - fly
dse04320  Dorso-ventral axis formation
dse04350  TGF-beta signaling pathway
dse04933  AGE-RAGE signaling pathway in diabetic complications
Module
dse_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsec_GM16932
   04350 TGF-beta signaling pathway
    Dsec_GM16932
   04068 FoxO signaling pathway
    Dsec_GM16932
   04150 mTOR signaling pathway
    Dsec_GM16932
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dsec_GM16932
  Cell growth and death
   04214 Apoptosis - fly
    Dsec_GM16932
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dsec_GM16932
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dsec_GM16932
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsec_GM16932
Protein kinases [BR:dse01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dsec_GM16932
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     Dsec_GM16932
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsec_GM16932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase YukC Choline_kinase FTA2 Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 6620522
NCBI-ProteinID: XP_002044725
FlyBase: FBgn0171845
UniProt: B4ILW5
AA seq 340 aa AA seqDB search
MEEFNSNGSVVNGTGSMEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLT
SQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCL
METDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALAL
DLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEVLHIT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaggaattcaattcgaacggatcagtagttaacggtacaggatctatggaagttcct
caatctaatgctgaagttataaggggacaaatatttgaagtgggtcctcggtatattaaa
ctcgcctatataggtgaaggagcttatggaatggttgtgtctgcagatgacacgctaaca
agccaaagagttgcaataaaaaaaatttcgccctttgaacaccaaacttattgtcaaagg
actctcagagaaataaccatattgaccagatttaaacatgaaaacattattgatattcga
gatattcttcgagttgatagcatagaccaaatgagagatgtttacattgtacagtgtttg
atggagactgatttgtataaactacttaaaacacagaggctaagtaatgatcacatctgt
tacttcttatatcagatattgcgtggactgaagtacattcattccgcaaacgtcttgcat
cgggaccttaagccgagtaatttactgttaaacaagacgtgcgacttaaaaatttgcgac
tttggattggctcgtattgcagatcccgagcacgaccatactggctttctcacagaatac
gttgctacccggtggtatagagcacctgaaataatgcttaactcaaaaggatacacaaaa
tctattgatatatggtccgttggctgcattttggctgaaatgttaagtaatcgtccaata
ttccctggaaaacattatctggatcaacttaaccatattcttggagtgttggggtcgccg
tcccgagacgatttagagtgtattattaatgaaaaggcacggaactatttggaatcttta
ccatttaagccaaatgtaccctgggcaaaactttttccaaatgctgatgcgttggcttta
gacctccttggaaaaatgttaacttttaatccgcataaacggattcctgtcgaggaagct
cttgcacatccctatttagagcaatattatgatcctggagatgaggtactacatataaca
tag

DBGET integrated database retrieval system