KEGG   Drosophila sechellia: Dsec_GM16932Help
Entry
Dsec_GM16932      CDS       T01064                                 

Definition
GM16932 gene product from transcript GM16932-RA
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dse  Drosophila sechellia
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsec_GM16932
   04350 TGF-beta signaling pathway
    Dsec_GM16932
   04068 FoxO signaling pathway
    Dsec_GM16932
   04150 mTOR signaling pathway
    Dsec_GM16932
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dsec_GM16932
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsec_GM16932
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dsec_GM16932
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsec_GM16932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 340 aa AA seqDB search
MEEFNSNGSVVNGTGSMEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLT
SQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCL
METDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALAL
DLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEVLHIT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaggaattcaattcgaacggatcagtagttaacggtacaggatctatggaagttcct
caatctaatgctgaagttataaggggacaaatatttgaagtgggtcctcggtatattaaa
ctcgcctatataggtgaaggagcttatggaatggttgtgtctgcagatgacacgctaaca
agccaaagagttgcaataaaaaaaatttcgccctttgaacaccaaacttattgtcaaagg
actctcagagaaataaccatattgaccagatttaaacatgaaaacattattgatattcga
gatattcttcgagttgatagcatagaccaaatgagagatgtttacattgtacagtgtttg
atggagactgatttgtataaactacttaaaacacagaggctaagtaatgatcacatctgt
tacttcttatatcagatattgcgtggactgaagtacattcattccgcaaacgtcttgcat
cgggaccttaagccgagtaatttactgttaaacaagacgtgcgacttaaaaatttgcgac
tttggattggctcgtattgcagatcccgagcacgaccatactggctttctcacagaatac
gttgctacccggtggtatagagcacctgaaataatgcttaactcaaaaggatacacaaaa
tctattgatatatggtccgttggctgcattttggctgaaatgttaagtaatcgtccaata
ttccctggaaaacattatctggatcaacttaaccatattcttggagtgttggggtcgccg
tcccgagacgatttagagtgtattattaatgaaaaggcacggaactatttggaatcttta
ccatttaagccaaatgtaccctgggcaaaactttttccaaatgctgatgcgttggcttta
gacctccttggaaaaatgttaacttttaatccgcataaacggattcctgtcgaggaagct
cttgcacatccctatttagagcaatattatgatcctggagatgaggtactacatataaca
tag

DBGET integrated database retrieval system