KEGG   Drosophila sechellia: Dsec_GM16961Help
Entry
Dsec_GM16961      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM16961-PA
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
dse  Drosophila sechellia
Brite
Ribosome [BR:dse03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dsec_GM16961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 TF_Zn_Ribbon RecR
Motif
Other DBs
NCBI-GeneID: 6614779
NCBI-ProteinID: XP_002039198
FlyBase: FBgn0171874
UniProt: B4I638
AA seq 204 aa AA seqDB search
MLPIARGIYSGLANITRNSRGALHTASALRCKAESSTEENDAAANEGEGEDNASGTAPDP
KDRSKAIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
LTYDVPFREYDYDEYYGQEQKQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgattgcacgtgggatttacagtggactggccaacattaccaggaatagccgg
ggagctcttcacacggccagcgccttgagatgcaaggcggagtcttctactgaagaaaat
gatgcggctgccaacgagggcgaaggcgaggataacgctagtggtaccgcgccggacccg
aaggatcgcagcaaggcaataccggtggagacctcgattcgatacttgaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcgcaaaacacgcaagacgtgcatccgccagaaccgcatcagcaccgga
aacccctgtcccatttgccgtgatgagtacctggtgctggactaccgcaacacggagctc
ctggagcagttcatatcgccccacagcggagacgtcctcagctactcaaagacaggcctg
tgtcaaaagagccacctacgtctaatggtcgccgttcagcaagcccgcgactccggctac
cttacatacgatgtgccattcagggagtatgattacgacgagtactacggccaggagcag
aagcaaaaagcttaa

DBGET integrated database retrieval system