KEGG   Drosophila sechellia: Dsec_GM16961Help
Entry
Dsec_GM16961      CDS       T01064                                 

Definition
GM16961 gene product from transcript GM16961-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dse  Drosophila sechellia
Brite
Ribosome [BR:dse03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dsec_GM16961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 204 aa AA seqDB search
MLPIARGIYSGLANITRNSRGALHTASALRCKAESSTEENDAAANEGEGEDNASGTAPDP
KDRSKAIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
LTYDVPFREYDYDEYYGQEQKQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgattgcacgtgggatttacagtggactggccaacattaccaggaatagccgg
ggagctcttcacacggccagcgccttgagatgcaaggcggagtcttctactgaagaaaat
gatgcggctgccaacgagggcgaaggcgaggataacgctagtggtaccgcgccggacccg
aaggatcgcagcaaggcaataccggtggagacctcgattcgatacttgaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcgcaaaacacgcaagacgtgcatccgccagaaccgcatcagcaccgga
aacccctgtcccatttgccgtgatgagtacctggtgctggactaccgcaacacggagctc
ctggagcagttcatatcgccccacagcggagacgtcctcagctactcaaagacaggcctg
tgtcaaaagagccacctacgtctaatggtcgccgttcagcaagcccgcgactccggctac
cttacatacgatgtgccattcagggagtatgattacgacgagtactacggccaggagcag
aagcaaaaagcttaa

DBGET integrated database retrieval system