KEGG   Drosophila sechellia: Dsec_GM17196Help
Entry
Dsec_GM17196      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM17196-PA
  KO
K08738  cytochrome c
Organism
dse  Drosophila sechellia
Pathway
dse01100  Metabolic pathways
dse04214  Apoptosis - fly
dse04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dse00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dsec_GM17196
   04215 Apoptosis - multiple species
    Dsec_GM17196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 6614410
NCBI-ProteinID: XP_002038843
FlyBase: FBgn0172107
UniProt: B4I533
AA seq 105 aa AA seqDB search
MGSGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGV
TWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKSNK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggttctggtgatgcagagaacggcaagaaaatctttgtgcagaagtgcgcccagtgc
cacacctacgaagtgggcggtaaacacaaagtgggcccaaatcttggcggggtcgtgggt
cgcaagtgtggcacagcagcgggatacaagtataccgatgccaatataaagaagggcgtt
acctggacagaggggaatttggacgagtacctcaaggacccgaagaaatacattcccgga
acaaagatggtgttcgcaggtctcaaaaaggctgaggagcgggccgatttgattgccttc
ctcaagtcaaacaagtag

DBGET integrated database retrieval system