KEGG   Drosophila sechellia: Dsec_GM17197Help
Entry
Dsec_GM17197      CDS       T01064                                 

Definition
GM17197 gene product from transcript GM17197-RA
Orthology
K08738  
cytochrome c
Organism
dse  Drosophila sechellia
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dsec_GM17197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttcctgctggtgatgttgagaagggcaagaagctgttcgtgcagcgctgcgcc
cagtgccacaccgttgaggctggtggcaagcacaaggttggacccaatctgcatggtctg
atcggtcgcaagaccggacaggcggctggtttcgcatacacggacgcaaacaaggctaag
ggcatcacctggaacgaggacaccctgttcgagtacctggagaaccccaagaagtacatc
cccggcaccaagatgatcttcgccggtctgaagaagcccaacgagcgcggcgatctgatc
gcctacctgaagtcggccaccaagtaa

DBGET integrated database retrieval system