KEGG   Drosophila sechellia: Dsec_GM17901Help
Entry
Dsec_GM17901      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM17901-PA
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dse  Drosophila sechellia
Pathway
dse04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsec_GM17901
Enzymes [BR:dse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dsec_GM17901
Chaperones and folding catalysts [BR:dse03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dsec_GM17901
Membrane trafficking [BR:dse04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dsec_GM17901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA Thioredoxin_9 Thioredoxin_3 Thioredoxin_4 Redoxin DDE_Tnp_1_2
Motif
Other DBs
NCBI-GeneID: 6613699
NCBI-ProteinID: XP_002038169
FlyBase: FBgn0172808
UniProt: B4I230
AA seq 433 aa AA seqDB search
MRQLGSILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVVKDDAIWVVEFYAPWCGHCQS
LVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTA
KAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVE
FFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSK
RASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEITNESTFETACEGKPLCVVSVLPH
ILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNF
KKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEED
IDLSDIDLDKDEL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaactggggagcattttgttgctggcatttgtcgtgggcagcgttagtgccttc
tattcgcccagcgatggcgtcgtggagttgacgccctcgaatttcgaccgggaggtggtt
aaagacgacgccatctgggtcgtggagttctatgctccatggtgcggccattgccagagc
ctggtgcccgagtacaagaagctggccaaggcattgaagggagtcgtgaaagtgggctcc
gtgaatgccgatgcggacagcacgctgagtggccagttcggtgtacgtggctttcccacc
atcaagatctttggcgccaacaagaagtcgcccacggactacaatggtcagcgaacggct
aaggccatcgctgaagccgctctggcggaggtcaagaagaaggtgcagggtgtcctgggc
ggcggcggtggatcgtcttccggcggttcgggcagctcgtccggcgatgatgtcatcgaa
ctcaccgaggacaacttcgacaaactggtcctgaactccgacgacatatggctggtggaa
ttcttcgccccctggtgtggtcactgcaagaacctggcacccgaatgggccaaggccgcc
aaggagttgaagggcaaggtcaagttgggcgccctggatgccaccgcgcatcagagcaag
gccgccgaatacaatgtgcgtgggtaccctaccattaagttcttccctgcgggttccaag
cgagccagtgatgcccaggagtatgatggcggacgcactgcctccgatattgtgtcgtgg
gccagtgacaagcatgtggccaatgtgccagcacccgaactcatcgagattaccaatgaa
tccacttttgaaactgcctgcgaaggaaagccattgtgcgtcgtgtccgttctgccacac
attctcgactgcgatgccaagtgccgcaacaaattcctcgacacattgcgcaccctgggc
gagaagttcaagcagaagcaatggggctgggcctgggcagaaggtggccagcagttggcc
ctggaagagtcgctcgaagtgggaggattcggctatccggccatggctgtggtcaacttc
aagaagatgaaattctccgtgctcaagggctccttctccaaggacggcatcaacgagttc
ctgcgcgacatctcctacggacgtggccacacggcgcctgttcgcggagccaagaaacct
gcgattgtgtccgtggatccttgggacggcaaagatggccaactgcccaccgaggaggac
atcgatctgagcgacatcgatctggataaggacgagctgtaa

DBGET integrated database retrieval system