KEGG   Drosophila sechellia: Dsec_GM17960Help
Entry
Dsec_GM17960      CDS       T01064                                 

Definition
GM17960 gene product from transcript GM17960-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dse  Drosophila sechellia
Module
cGMP signaling
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dsec_GM17960
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dsec_GM17960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1013 aa AA seqDB search
MACFPRLFHHRSKNKFTPAEDENTDTILNTHDSPVQIGQYIRREEKPLYSPIVTPSASEA
KLQRLRQQPPGSPPAPARWTLQSVAENGSANNGVQERKFRSNKDKLQAQDACPSGGSAIN
VTRSSSKLKPVKERRPTALPTEVPSIEIEDVRDAGDGKDSLGERVALQPGANAHVDVVDG
GGKSKLKVNVNGIIDEGVAHDDDDDTPSSTSIATTPVTEGPVKFFIGHTQELSPQQTDDT
LSCQSSDANNNNNSSSSSSAAKQTNGVLPQEQPEREQDRKHDSRGNQQALQAPSRAKSSS
NVSLNYLAKSQTDSQRRRRVSTMPDINIPPAPPLPPELLVPGTPLHLRKKRSVERPQQQE
QQQQEIQQDATNSQDQIAGAEEGGESHKSSDSSTPKTHRVEGGLIYVRPNFPIQGDIEIE
SIAKDEGTRNLIRTAIERNDFLNNLMDKERKEMVINAMAPASYRKHNLIIREHEEGSEIY
VSAEGQYDVIRGGQLVASFGPATVFGELAILYNAPRQASVEAATDARVWKIARETFRAIM
QISGSREREENLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSCIVREGELGNEFYII
RCGTVTIKKRDDQQQEQIVANRKRGDYFGEQALLNADVRQASVYADAPGTEVLMLDREAF
ISYLGTIKQLREKPSSQRNDTSGRSSNKSLEFDNEYSQVAISELKKIATLGCGAFGRVDL
VAYNQQALALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFLM
EACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPENLMLGTDGYC
KLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYELLVGKTPF
RGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRHSW
FESLDWQRLKLKQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPEELSGWDKDF
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccccgacttttccatcatcgcagcaaaaacaaattcacgcccgccgaa
gatgagaacaccgatacgatactcaacacacatgatagtcccgtgcaaattggccagtac
atccgtcgcgaggagaagccactgtactcgcccatcgtcactccgagtgccagtgaggcc
aaacttcagcgcctcagacagcagccacccggctcaccgcccgcacccgccaggtggacc
ctgcagtcggttgccgaaaatggcagcgcaaacaatggcgtccaggagcggaagttccgc
tccaacaaggacaaactgcaggcgcaggatgcatgcccatccggcggcagtgcaattaat
gtcacacgctcaagttcgaaattaaaaccagtcaaagagcgtcggcccaccgccttgccc
accgaggtgcccagcatcgagatcgaggatgttcgggatgctggagatggcaaggattca
ctgggggagcgggtggcgttgcagccgggtgctaatgcacatgtcgatgtcgtcgatggc
ggcggcaagtcaaaactcaaagtgaatgtgaatggcataattgatgagggcgtcgcccac
gacgatgacgatgacacaccctcgagcacctccatagccacaacacctgtgaccgagggt
cctgtaaagtttttcattggtcacacgcaggaactaagcccccagcaaacggatgacacc
ttgtcctgccagagtagcgatgccaacaacaacaacaacagcagcagcagcagcagtgcc
gccaaacagacaaatggcgtcctgccacaggagcaaccggaacgggaacaggacaggaaa
cacgattccagggggaaccagcaagcactccaggctccgtcccgcgccaagagctccagc
aacgtgtcactcaattatctggccaagagccagacggacagccagcgtcgccgacgtgtg
tccacgatgcccgatattaacataccgccagcaccgccgttgcctccggaactcctcgtc
cccggaacgccgctccatctgcgcaagaaacggagcgtggagcgaccgcagcagcaggag
cagcagcagcaagagatccagcaggatgctacgaatagtcaagatcaaattgcaggagca
gaggagggcggcgagagtcacaagtccagcgattcctcgacaccaaaaacccatcgcgtg
gaaggtggcctcatctatgtccgtcccaattttcccattcagggcgacattgaaatcgaa
tctattgcaaaggacgaaggcacacgcaatctcatacgaacggccattgagcgcaatgat
ttcctcaataatctaatggacaaggagcgcaaggagatggttatcaatgcaatggccccg
gccagctacaggaagcacaacctcatcatccgggagcacgaggagggttccgagatatat
gtctccgccgagggccagtacgatgtcatccgtggtggccaactggtggccagctttgga
ccggccaccgtgttcggtgagctggccattctctacaatgctccgcgtcaggcgtccgta
gaggctgccaccgatgcacgcgtttggaaaatcgcacgcgaaaccttccgggccatcatg
caaatctcggggtccagggagcgcgaggagaacctacagttcctgcgctccgctccattc
ctgcaggagttcgaccagagtttgttgctcaaagtcgtggatcttctgcagcggaaattc
tacgagaccgacagctgtattgtccgcgaaggtgagctgggcaacgagttctacatcatc
cggtgcggaactgtgaccataaagaagcgggacgaccagcagcaggagcagattgtggcg
aatcgaaagcgaggtgactacttcggggaacaggccctgctcaatgcggatgtgcgacag
gccagtgtctatgcggatgcaccgggcaccgaggtcctcatgctggacagagaagccttc
attagctatttgggaaccataaagcagctgcgcgagaagcccagtagtcaacgcaacgat
acgagtggtcgatccagcaacaaatccctggagttcgacaacgagtactcccaggtggcc
atctcggagctgaagaagatagccacgctgggctgcggcgcctttggacgtgtggatctg
gtggcctacaaccaacaggcgttggccctgaagatcatcaagaaaatcgaggtggtcaag
caagatcaaatagagcacgtttacaacgagaagaacgttatgatcaagtgccgccaatcg
cccttcatagtacaactgtatcgcacgtaccgcaatgacaaatacgtttacttcctaatg
gaggcctgcatgggcggtgatgtatggacggtgatgtcaaagcgccagtacttcgatgag
aagaccgccaaatttatagcgggctgtgtcgtcgaggcctttgactatttgcactcccac
cacttcatctacagggacttgaagccagagaatctgatgctgggcaccgatggctattgc
aaactggtcgattttggatttgccaaatttgtgcgacaaaatgagaagaccaacacattt
gctggtacaccggagtacgtggcacccgagataatcctggatcgaggacacgatcgcgcc
gtcgactattgggcactgggaattctggtatatgaacttctggttggaaaaacgcccttc
aggggcgttaaccagatcaagatctatcagcaaatcctcagcggcatcgatgtcatccac
atgccatcgcgcatacccaaatccgcacagcacctggtgcggcatctctgcaagcaactt
ccggcggaaagactgggatatcagcgcaagggaatcgcggatatcaagcggcatagttgg
ttcgaaagtctcgactggcagagactgaaacttaagcaattgccatcgcccatcaaaaga
cctttgaagagttggaccgacttgcaatattttggtccttcgggagttgagaacgactat
gagccaccggaggaactgagcggatgggataaagacttttaa

DBGET integrated database retrieval system