KEGG   Drosophila sechellia: Dsec_GM17979Help
Entry
Dsec_GM17979      CDS       T01064                                 

Definition
(RefSeq) GM17979 gene product from transcript GM17979-RA
  KO
K05759  
profilin
Organism
dse  Drosophila sechellia
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsec_GM17979
Membrane trafficking [BR:dse04131]
 Others
  Actin-binding proteins
   Others
    Dsec_GM17979
Cytoskeleton proteins [BR:dse04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dsec_GM17979
Exosome [BR:dse04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dsec_GM17979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSNGFEVTKEELSKLISGFDQQDGLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgacggcaacatttgggcgcagtccaatggctttgaggtgacaaaa
gaggagctctccaaactgatcagcggctttgaccagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggtacatttacctttccggcacagaccgcgtggtgcgcgcc
aagctcggccggagcggagtgcactgcatgaagacaacacaagccgtgatcgtttccatc
tacgaggatcccgttcagcctcagcaggccgcttccgtggtagagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system