KEGG   Drosophila sechellia: Dsec_GM17979Help
Entry
Dsec_GM17979      CDS       T01064                                 

Definition
GM17979 gene product from transcript GM17979-RA
Orthology
K05759  
profilin
Organism
dse  Drosophila sechellia
Brite
Exosome [BR:dse04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dsec_GM17979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSNGFEVTKEELSKLISGFDQQDGLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgacggcaacatttgggcgcagtccaatggctttgaggtgacaaaa
gaggagctctccaaactgatcagcggctttgaccagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggtacatttacctttccggcacagaccgcgtggtgcgcgcc
aagctcggccggagcggagtgcactgcatgaagacaacacaagccgtgatcgtttccatc
tacgaggatcccgttcagcctcagcaggccgcttccgtggtagagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system