KEGG   Drosophila sechellia: Dsec_GM18132Help
Entry
Dsec_GM18132      CDS       T01064                                 

Definition
GM18132 gene product from transcript GM18132-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 813 aa AA seqDB search
MRFCFDRLCFATKRPAQNSNSNAPHSSGTVDAPPRPADVDVATVPAAPQSPLQQPVSNLF
YADYQKLQPAIIDRDWERDRDTDTDTRSEAKPPDIGEHIEPVEQQRQIHTQIQSPAEIQI
QIPPPPPAQSSQQRYRRHSSAEDRNLNTRRNDSNTTEALRKAASMQQEPNANYQFPTDLG
LVSIVNNNNNTNTHPSGSNSGSNNNSNINNNLVGGIVTLPAAGGLIGLEHTASGLRLIPA
PPTHSDVLTHTLIYGTPPSGAQQLNQDPRTLLHQQELQLQQRYQQLQQLQAQTQGLYTSQ
GSPVLYHQPSPGSSQPVAIPGATCHSPTQLQPPTTLNLQQQMQSLRISGCTPSGSGGSAT
PSPVGLVDPNFIVSNYVAASPQEERFIQIIQAKELKIQEMQRALQFKDNEIAELKSHLDK
FQSVFPFSRSSAAGCAGTGGASGSGAGGSGGSGLSTATGATRKSGQNFQRQRALGISAEP
QSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKN
LIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECN
LWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYI
VRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICE
SADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKWFDGFYWWGLQNCTLEPPIKP
AVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctgctttgatcggctgtgcttcgcaaccaagcggccagcccaaaactccaac
agcaatgcaccacacagcagcggcactgtagatgcaccaccacgtccagcggatgtagat
gtagccactgttccagcagcaccacaatcaccactgcaacagccagttagtaatctgttc
tatgccgactaccagaagctgcagccggcgataatcgatcgggactgggagcgggacaga
gatacagatacagataccaggagcgaggccaagccaccggacattggggagcacatagaa
cccgtagagcagcagagacagatacacacacagatacagtcgccggcagagatacagata
cagatacccccgccgccccctgcccagtcgtcacagcagcgctatcgccggcacagcagt
gccgaagatcgcaatctgaacacgaggcgaaacgattcgaatactacggaggcgttacga
aaagcagccagtatgcagcaggagccgaacgccaactatcagttcccaaccgacttgggt
ctggtgagcatcgtcaacaataataataacacaaacacccatccgagtggatccaacagc
ggcagcaacaacaacagcaatatcaacaataatctggtgggtggcattgtgaccttgccg
gcggctggtggtctcataggtctggagcatacggcgtcgggtctgcgactgataccagca
ccgcctacccactcggatgtgctgacccacacgctgatctatggcacaccgccctcgggc
gcccagcaattgaaccaggatccccgaacccttctgcaccaacaggagctgcagctgcag
cagcgctatcagcaattgcagcagcttcaggcgcagacgcagggcctgtacaccagccaa
ggaagtccggtgctgtaccaccaacccagtccgggatcgagtcaaccggtggcgataccc
ggtgccacttgccattcgcccacgcaactgcagccgcccaccacgctgaacctgcagcag
cagatgcagagtctgcggatctcgggatgcacgcccagcggttcgggtggctcggccacg
ccctcgccggtgggcctggtggatccgaacttcatagtgagcaactatgtggccgcctcg
ccgcaggaggagcgcttcatccagatcattcaggccaaggagctcaagatacaggaaatg
caaagggccctccagttcaaggacaacgaaatagccgagctcaagtcccacttggacaaa
ttccagagtgtgttccccttcagccgcagcagtgcggccggatgtgcgggcacgggcgga
gcatcgggatctggagccggcggaagtggcggcagtggtctcagcaccgccacaggtgcc
acccgcaagtcgggacagaatttccagaggcagagggcattgggtatctccgccgagcca
cagagcgagtcctcactgctcctcgagcacgtcagctttcccaaatacgacaaggatgag
cgctcccgtgaacttatcaaggctgccatattggataatgatttcatgaagaacctggat
ctgacgcagatccgcgagatcgtcgactgcatgtatccggtcaagtatccagccaagaat
cttatcatcaaggagggagatgtcggaagcatcgtttatgtcatggaagatggacgcgtg
gaggtttcccgcgagggcaagtacctctccacattgtcgggagcgaaggtccttggcgaa
ctggcgatcctgtacaactgccagcggactgcgaccatcaccgcgatcaccgagtgcaac
ctgtgggccatcgagcgccagtgcttccagaccatcatgatgcgaacgggcctgatccgg
caggcggagtacagcgacttcctcaagagtgtgcccatcttcaaagacctggcggaagac
acgctcatcaaaatctccgatgtcttggaggagacacactaccagcgtggcgactacata
gtgcgccagggcgcccgaggcgataccttcttcatcatctccaagggaaaagtgcgagtg
acgatcaagcagcaggacacgcaggaggagaagttcattcgcatgctgggcaaaggggat
ttctttggagaaaaggctctccagggcgatgatctgcgcacggcgaatattatttgcgag
tccgccgatggcgtcagttgtctggtcatcgatcgcgagaccttcaatcagctaatttcc
aatctggacgagatcaagcatcgctacgacgacgagggcgccatggaacgcagaaaatgg
ttcgatggcttctattggtggggcctgcagaactgcaccctggaaccgcccattaagccc
gccgtgaaaagcgtggtcgatacaacaaactttgatgactatcctcccgatccagagggt
ccgccgccagacgatgtcactggatgggacaaggacttctga

DBGET integrated database retrieval system