KEGG   Drosophila sechellia: Dsec_GM18256Help
Entry
Dsec_GM18256      CDS       T01064                                 

Definition
GM18256 gene product from transcript GM18256-RA
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsec_GM18256
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dsec_GM18256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 227 aa AA seqDB search
MLTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETY
EKHRAEEHDRIKELQEQHPDDLFYMRQFTHNACGTVALIHSVANNKEVDIDSGVLKDFLE
KTVSLSPEERGKALENDKEFTADHQALAQEGQTNAADHVKVIHHFIALVNKEGTLYELDG
RKSFPIKHGPTSEETFVKDAAKVCKEFMARDPNEVRFTVLALTATKQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttgacctggacaccacttgaatctaatcccgaggttttgaccaagtatatacataaa
ctgggcgtgtcgccagcctggtcggtaactgacgtcatcggattggaagatgacaccttg
gaatggattccgcgtcccgtaaaggcgttcattttgctctttccgtgcagcgaaacctat
gagaagcaccgcgccgaggagcacgatcggatcaaggagttgcaggagcagcatcccgac
gatctcttctacatgcgccagttcacccacaacgcctgtggaaccgtcgcccttatccac
agcgtggccaacaacaaagaagtggacatagacagcggagtactgaaggacttcctggag
aagacagtttccttgtccccggaggaacgcggaaaggccctggagaacgacaaagagttc
accgccgatcatcaggccttggctcaagagggccagaccaatgccgccgatcatgtaaag
gtgattcaccacttcatcgcgctggtgaacaaggagggtactctgtacgagctggatggc
cgcaagtccttcccgatcaagcacggaccgacttcggaggagacttttgtgaaggatgcg
gccaaggtctgcaaggagttcatggctcgcgatcccaatgaagtgcgcttcaccgttttg
gccctgactgcgaccaaacagtag

DBGET integrated database retrieval system