KEGG   Drosophila sechellia: Dsec_GM18256Help
Entry
Dsec_GM18256      CDS       T01064                                 

Definition
GM18256 gene product from transcript GM18256-RA
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 227 aa AA seqDB search
MLTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETY
EKHRAEEHDRIKELQEQHPDDLFYMRQFTHNACGTVALIHSVANNKEVDIDSGVLKDFLE
KTVSLSPEERGKALENDKEFTADHQALAQEGQTNAADHVKVIHHFIALVNKEGTLYELDG
RKSFPIKHGPTSEETFVKDAAKVCKEFMARDPNEVRFTVLALTATKQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttgacctggacaccacttgaatctaatcccgaggttttgaccaagtatatacataaa
ctgggcgtgtcgccagcctggtcggtaactgacgtcatcggattggaagatgacaccttg
gaatggattccgcgtcccgtaaaggcgttcattttgctctttccgtgcagcgaaacctat
gagaagcaccgcgccgaggagcacgatcggatcaaggagttgcaggagcagcatcccgac
gatctcttctacatgcgccagttcacccacaacgcctgtggaaccgtcgcccttatccac
agcgtggccaacaacaaagaagtggacatagacagcggagtactgaaggacttcctggag
aagacagtttccttgtccccggaggaacgcggaaaggccctggagaacgacaaagagttc
accgccgatcatcaggccttggctcaagagggccagaccaatgccgccgatcatgtaaag
gtgattcaccacttcatcgcgctggtgaacaaggagggtactctgtacgagctggatggc
cgcaagtccttcccgatcaagcacggaccgacttcggaggagacttttgtgaaggatgcg
gccaaggtctgcaaggagttcatggctcgcgatcccaatgaagtgcgcttcaccgttttg
gccctgactgcgaccaaacagtag

DBGET integrated database retrieval system