KEGG   Drosophila sechellia: Dsec_GM18474Help
Entry
Dsec_GM18474      CDS       T01064                                 

Definition
GM18474 gene product from transcript GM18474-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsec_GM18474
Transfer RNA biogenesis [BR:dse03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dsec_GM18474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 552 aa AA seqDB search
MKAKKKLGVGLSRQERQVLVIGEIIQELLKAHEAKKDVNLNRMKSLVASKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRSRYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLP
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLSY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKGECSIVRELHVY
GSVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSTKLAVISGVGTRNYYRKMGYELD
GPYMSKSIEEIN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaaaaagaagttgggcgtgggattgagccgccaggaacggcaggtgctcgtc
atcggggagatcattcaggagctgctaaaggcgcacgaagccaaaaaggatgtaaacctt
aaccggatgaaatcattggtggcctccaaatatggactggacagttcgccgcgcttggtc
gacatcattgcagccgtgccgcaggacgccaaaaaaattctgctcccaaagctgagggcc
aagcccattcgcacagcaagtggcatcgccgtggtggccgtcatgtgcaagccgcatcgt
tgtccgcacatcaacatgaccggcaatatatgcgtctattgtcccggcggaccggacagc
gactttgagtactcgacacagtcgtacacaggctacgagccgacctcaatgcgagccatc
cggtcgcggtacgatccctttcttcagacccgacaccgcgttgaacaactaaagcagctg
ggacacagtgtggacaaggtggagttcatcgtaatgggcggtaccttcatgtgcctgccg
gaggagtaccgcgactacttcatccgcaacctgcacgacgccctatccggccacagcagc
gccaatgtagcggaggccgtacgctactcggagaagtcgcgcacaaagtgcattggcatc
accatagaaacaaggccggattactgcctcaagcggcacatatcggatatgcttagctat
ggttgcacccggttggaaatcggtgtgcaatcggtttacgaagacgtagccagggatacg
aaccgtggacacacggtgcgagcggtgtgcgagagctttcagctaggcaaggatgctggc
tacaagatcgtgacgcacatgatgcctgatcttcccaatgtggacttcgaacgcgacatc
gagcagttcatcgagtactttgagaaccctgcctttcgctctgacggcctaaagatctat
cccacgctagtcattcgcggcactggtctctacgagttatggaaaaccgggcggtataag
tcatatccgccatccatgcttgtcgacctagtggccaagattttggcccttgtaccacca
tggacgcgagtgtaccgcgtacagcgcgacattcccatgccgcttgttagttccggcgtg
gaacacggaaatctccgggaactggcgctggcccgcatgaaggatcttggcaccacttgc
cgcgacgttagaacccgcgaagttggcattcaggaaatccacaacaaggtgcgcccttac
gaaattgagctaattcgtcgggactatgtagccaatggcggctgggaaacgttcctctca
tacgaagatcctgaacaggacattctcgtaggccttcttaggctgcgaaagtgttcaccg
gataccttccgcccggaactgaagggagaatgctccattgtgagagagctgcacgtatat
ggctcagtcgtgccggttaatgctagggatcccaccaagtttcagcaccagggcttcggt
atgttgctgatggaggaggcggagcgaattgctcgagaggagcacggcagcacaaaactg
gcggtcatatcgggagtgggcaccaggaactactaccgcaaaatgggatacgaacttgac
ggaccctacatgtcaaagagcatagaagaaattaactaa

DBGET integrated database retrieval system