KEGG   Drosophila sechellia: Dsec_GM18614Help
Entry
Dsec_GM18614      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM18614-PA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dse  Drosophila sechellia
Pathway
dse00040  Pentose and glucuronate interconversions
dse00053  Ascorbate and aldarate metabolism
dse00830  Retinol metabolism
dse00860  Porphyrin and chlorophyll metabolism
dse00980  Metabolism of xenobiotics by cytochrome P450
dse00982  Drug metabolism - cytochrome P450
dse00983  Drug metabolism - other enzymes
dse01100  Metabolic pathways
Module
dse_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsec_GM18614
   00053 Ascorbate and aldarate metabolism
    Dsec_GM18614
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsec_GM18614
   00860 Porphyrin and chlorophyll metabolism
    Dsec_GM18614
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsec_GM18614
   00982 Drug metabolism - cytochrome P450
    Dsec_GM18614
   00983 Drug metabolism - other enzymes
    Dsec_GM18614
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsec_GM18614
Glycosyltransferases [BR:dse01003]
 Others
  Hydrophobic molecule
   Dsec_GM18614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 6613602
NCBI-ProteinID: XP_002038072
FlyBase: FBgn0173520
UniProt: B4I1T3
AA seq 535 aa AA seqDB search
MGGILRCLALQIVVLIAGAHGANILGLFTSLSPSHLVIQMSMARILAERGHNVTVVTVLK
PPSLHKDINHILVPMEEDILQAFGSLVGGMTKTDNSNAYTSMFRSVRQLSETFSRMGDVM
KQPLVRDLYEHPDNKFDLVMVGYFMNSYQLALAHKLKVPLVLALSNPPSFLGYFLGNPWE
VSYVPAMNMAIESGKPLGIGHRMLNLLGNLAQRLFMFIIEFRNARIYRDIYGDDPTLPSY
EDLNKNISLIFFASHGISEGPIRPNVPAVIEIGGIQVKDQPDKLPQNLEQFLSEAPHGAI
LLSLGSNLKKDHLKSYTVQKMFNVLSKLQQKVIWKWDDLDNLPGESDNILYSKWVPQDDV
LAHPNITLFINHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMQGFGIKQSILTLEE
DSFLQGIREVLDNPKYATAVKSFSTLYRDRPLSARETLIYWVEYVIRHHGAPHIQSPVVH
MSYIAANNLDVYAVILGTIVALCFITKLVLSLIVRKIRNNSTKAKVNQNHKLKKK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaattttgaggtgcctcgccctccagatagtggttctgattgccggagcccat
ggagccaacattctgggtctgttcaccagcctgagtccgtcgcacttggtcatccagatg
tcgatggcccggattctagccgagagggggcacaacgtgactgtagtgacggtcctaaaa
ccaccgtctttacacaaggatatcaaccacattctggtgccaatggaagaggatatcctg
caggcattcggttctctggtcggtggaatgacaaagacggacaatagcaatgcatatacg
tccatgtttcgatcggtcagacagttgtccgagacgttctccaggatgggtgatgtgatg
aagcagccgttggttagagatctctacgagcacccggacaacaagttcgatttggtcatg
gtgggctactttatgaacagttatcaactggccctggcccacaaactgaaggttccgctg
gtgttggccctttcaaacccgccatcgtttttgggatactttttgggcaacccctgggaa
gtctcatatgtgcctgccatgaatatggccattgaaagtggcaaacccctgggcattgga
caccgtatgctcaacctgctgggaaacttggcacagcggctgttcatgttcataattgag
tttcggaatgccaggatctacagagatatctatggcgacgatcccactctgcccagctat
gaggacttgaacaaaaacatatcgctcatcttctttgcctcgcatgggattagcgaaggg
cccattcgtcccaatgtgccagctgtgatcgagatcggaggaatacaagtcaaggaccaa
cccgataagctgccacaaaacttggaacaattcctgagcgaagctccacacggagctatt
ctactcagcctgggatccaacctaaagaaggaccatttgaagtcatacacagtgcagaaa
atgtttaatgtgctctcgaagctgcagcagaaggtgatctggaagtgggacgacctggat
aacttaccgggagagtcggataacatactctactccaagtgggtgccgcaggacgatgtc
ctggcacatccgaacataacgctgttcatcaaccacgcgggaaagggcggcctaacggag
gcccagtatcatggcaaacccatgctggccctaccagttttcggtgaccagccctccaat
gcggatgttatggtgatgcagggctttggaatcaagcaaagcatcctcaccctggaggag
gacagcttcctgcagggcattcgagaggtactcgataatcccaagtatgccactgccgtc
aagtcgttctccactctctaccgggatcgtccattgagtgctcgggagaccctgatctac
tgggtggagtacgtgatccgccaccacggagctccgcacatccagagtccggtggtgcac
atgagctacatagcagccaataacctggacgtctatgctgtgatcctcggaacgattgtt
gctctctgctttattactaaattagtgttaagtttaattgttagaaaaattaggaacaat
tctacaaaggcaaaagttaatcagaatcataagctcaagaagaaatag

DBGET integrated database retrieval system