KEGG   Drosophila sechellia: Dsec_GM18621Help
Entry
Dsec_GM18621      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM18621-PA
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dsec_GM18621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 6613610
NCBI-ProteinID: XP_002038080
FlyBase: FBgn0173527
UniProt: B4I1U1
AA seq 679 aa AA seqDB search
MASEQTIDGAAAIPSGGGDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPTRSYSIQP
TTVCTTSASDNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEE
CDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVDLTGLNYAVFGLGNK
TYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGIEGG
GEEVLIRQYRLLEQPEVQPDRIYTGEIARLHSIQNQRPPFDAKNPFLAPIKVNRELHKGG
GRSCMHIELSIDGSKMRYDAGDHVAMFPVNDKSLVEKLGQLCNADLDTVFSLINTDTDSS
KKHPFPCPTTYRTALNHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKY
QSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVLV
EYKTPTGRINKGVATTYLKNKQPQGSEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTGLA
PFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDQ
GKKVYVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADA
VQYIKKMEAQKRYSADVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagcaaacgattgatggagcagccgcaattcccagcggcggcggcgacgaa
cccttcctgggcctgctggacgtagccctactggcggtgctaatcggcggcgcagccttc
tacttcctgcgcagccgcaagaaggaggaggagccaaccaggagctattccatacaaccc
actacagtgtgcaccacgagtgcgtcggacaactcgttcatcaagaagctcaaggcatct
ggacgcagtctggtcgtcttctatggatcacagaccggaacaggcgaggagttcgccggc
cgtctggccaaggagggcattcgttaccgtctaaagggcatggtggctgatcccgaggag
tgcgacatggaggagctgctgcagctgaaggacatcgacaactcgctggcggtcttctgc
ctggccacctacggcgaaggagatcccactgacaacgccatggagttctacgagtggatc
accagcggcgatgtcgacctgaccgggctaaattatgcggtctttggcttgggcaacaag
acctatgagcactacaacaaggtggccatctatgtggacaagcggctggaggagctgggc
gccaaccgggtcttcgaactgggactgggcgacgatgatgccaacatcgaggatgacttc
atcacgtggaaggatcgcttctggcccgccgtgtgcgaccacttcggcatcgagggcggc
ggcgaggaagtgctcatccgtcagtaccgtctgctggaacagccagaggtgcagcctgac
cgcatttacactggagagatcgcccgccttcactcgattcagaaccagcgcccgcccttc
gacgccaagaatcccttcctggcccccatcaaggtgaaccgcgagctgcacaagggcggt
ggccgctcctgcatgcacattgagctgagcatcgatggttccaagatgcgctacgacgcc
ggagatcatgtggccatgttccctgttaacgacaagagtttggtggagaagctcggccag
ctgtgcaacgccgatctggatactgtgttctcgctgatcaacaccgatacggacagcagc
aagaaacacccattcccttgccccaccacgtaccgcaccgctctgaaccactacttggaa
attacggccattccccgcacgcacatcctcaaggagctcgctgagtactgtactgacgag
aaggagaaggagttgctgcgcagcatggcctccatcagtcccgaaggaaaggagaaatac
cagagctggatccaagacgcctgtcgcaacattgtccacattctggaagacatcaaatcc
tgtcgccctcctatcgatcacgtttgcgagctgctgccccgcttgcagccgcgttactat
tccatctcgtcgtctgctaagctgcaccccactgatgtccacgtgacagccgttctcgtg
gagtacaagacgccgacgggacgcatcaacaagggcgtggccaccacatatctaaagaac
aagcaaccgcagggcagtgaggaagtaaaggtgccggtattcatccgcaagtcacagttc
cgtttgcctacgaagccagagacacctatcattatggttggtcctggcacgggcttggcc
cccttccgcggtttcattcaggagcgtcaattcctgcgcgatgagggcaagaccgtggga
gagtcgattctctacttcggttgccgtaagcgcagtgaggactatatctacgaatccgaa
ttggaggagtgggttaagaagggcactctaaacctgaaggccgccttttctcgtgaccag
ggcaagaaggtctacgtgcagcacctgctcgagcaggacgcagatcttatatggaacgtg
attggcgagaataaggggcacttctacatatgcggtgatgcaaagaacatggccgtggac
gttaggaacattttagtgaaaattttgtccactaagggtaacatgagcgaggctgacgcc
gtgcagtatatcaagaagatggaggctcagaagcgctactcggccgatgtctggagctaa

DBGET integrated database retrieval system