KEGG   Drosophila sechellia: Dsec_GM18944Help
Entry
Dsec_GM18944      CDS       T01064                                 

Definition
GM18944 gene product from transcript GM18944-RA
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
dse  Drosophila sechellia
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dsec_GM18944
Enzymes [BR:dse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dsec_GM18944
Transcription factors [BR:dse03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Dsec_GM18944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 898 aa AA seqDB search
MERNPRERLVRHIGAVKDCNLETVDLVESEGVSAWATLPRLTRYPGLILLNGNSRCHGRM
SPVALPEDPLTMRFPVSPLLRSCGEELRKTQQMELGMGPLGNNNNNYQQKNQNVILALPA
SASENIAGVLRDLANLLHLAPALTCKIIEDKIGNKLEDQFMNQDDEKHVDFKRPPSQVSH
GHLRKILNGRRKLCRSCGNVVHATGLRVPRHSVPALEEQLPRLAQLMDMLPRKSVPPPFV
YFCDRACFARFKWNGKDGQAEAASLLLQPAGGSAVKSSNGDSPGSFCASSTAPAEMVVKQ
EPEDEDEKTQGVPGNPTNIPAQRKCIVKCFSADCFTTDSASSGLELDGTADAGTGAGPVN
NTVWETETSGLQLEDTRQCVFCNQRGDGQADGPSRLLNFDVHLNCALWSNGVYETVSGAL
MNFQTALHAGLNQACSACHQLGATIRCFKSRCNSLYHLPCAIREECVFYKNKSVHCSVHG
HAHAGITMGAGAGATTGAGVGGSVAENELSSLVVHRRVFVDRDENRQVATVMHYSELSNL
LRVGNMTFLNVGQLLPHQLEAFHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGC
KPEFRIQVQDAGDKEPEREFRGSSPSAVWQQILQPITRLRKVHNGEDLFGLTEPAIVRIL
ESLPGIETLTDYRFKYGRNPLLEFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAGSCST
QRMANSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEK
HTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNP
NCVTEIVEVDRDVRIIIFAKRKIYRGEELSYDYKFDIEDESHKIPCACGAPNCRKWMN
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcaatcctagggaacgcctggtgcggcacattggagccgtcaaggattgcaat
ttagagaccgtagacctggtggagagcgaaggtgtatctgcgtgggcgactcttccacga
cttacccgctatccgggtctaatactgctcaatggaaacagccgttgccatggacggatg
tcgccggtcgcgctgccggaggatccgctgaccatgcgctttcccgtgtctccactgctt
cgatcctgcggcgaggagctgcgcaagacacagcagatggagctgggaatgggaccgctg
ggcaataataataataactatcagcagaagaaccagaatgtgatactcgcactgcccgcc
tcggcctcggagaacatagccggcgtgctgcgggatctggccaatctactgcacctggcg
cccgcccttacctgcaagatcatcgaggacaagattggcaataagttggaggaccagttt
atgaatcaggacgatgaaaagcacgtcgacttcaagcgaccaccgagtcaagtgagtcac
ggtcatctgaggaagatcctcaacgggcgccgtaagctctgccgcagctgcggaaatgtg
gttcacgccactgggctgcgagttcctcggcacagtgttcctgccctagaagagcaactc
ccccggttggcccaactgatggacatgctgccgagaaaatcggttccccctccttttgtg
tacttttgcgatcgcgcctgctttgcgagattcaagtggaacggaaaggatggccaggcg
gaggcggctagtctgctgcttcagccagcgggtggttctgctgtgaaatcatcaaacgga
gactcgcctggcagcttctgcgccagctcaactgccccagcggagatggtggtcaaacaa
gaaccggaggacgaggatgagaaaacgcagggcgtaccgggcaaccccacaaatattccc
gcacagcgcaagtgcatcgtgaagtgtttcagtgctgattgcttcaccacggactcggcg
tcatccggactggagttggacggaactgctgatgcgggaactggagctggaccggtcaat
aatactgtgtgggaaacagagaccagtgggctgcagttggaggacacgcggcagtgcgtc
ttctgcaatcagcgtggtgacggccaggcggatggaccctcgcgactgcttaacttcgat
gttcatcttaactgcgccctgtggtccaacggcgtgtacgagacggtgtctggggcgctg
atgaacttccagacagctctgcatgcgggactgaaccaggcgtgtagcgcatgtcaccaa
ctaggcgccaccatcaggtgtttcaagtcgcgctgcaacagcctgtaccacctgccatgc
gccattcgcgaggagtgcgtcttttacaagaacaagtccgtgcactgtagcgttcatggt
catgctcatgccggcatcacgatgggagcaggagcaggcgccacgactggcgccggagta
ggaggctctgtggcagagaatgaactgagctccctggttgtccaccgaagagttttcgtc
gatcgggatgaaaaccgtcaggtggccaccgtcatgcactattcagagctgagcaacctg
ctccgtgtgggcaacatgacgttcctgaacgtgggtcagttgctgccgcatcagctggag
gcctttcacacaccccactacatctaccccattggctataaggtgagtcgctactactgg
tgcgtgcgacgacccaatcgtaggtgtcgatacatttgcagtatcgcggaggccggatgc
aagcccgagtttcgcatccaggtgcaggacgccggcgacaaggagccggagcgcgagttt
cggggcagttcgccctcggcggtctggcagcagatcctgcagccaatcacgcgactgcgt
aaggtgcacaatggtgaggacctatttggtctaacggaaccggccattgtgcgaatcctg
gaaagcctcccgggcattgagacgctcactgactaccgcttcaagtacggtcgcaacccg
cttctggagttcccgctagccatcaatccgtctggagctgcgcgtacggaacccaagcaa
cgccagctgctcgtctggaggaagccgcatacgcaacgcacggccggcagctgcagcacg
cagcggatggccaactcggctgcgatcgccggggaggtggcctgcccctatagcaagcag
ttcgtgcattcgaagagctcccagtacaaaaagatgaagcaggagtggcgaaacaacgtc
tacttggcgaggtctaagatccagggtcttggcttgtatgcagctcgggacattgaaaag
cacaccatgataatcgagtacattggcgaggttatccgcaccgaggtctccgagatacgc
gagaagcagtacgagtccaagaaccgtggcatctacatgttccggctggatgaggaccgt
gtggtggacgccactctaagcggcgggttggcgcgctacatcaaccattcgtgcaatccc
aactgtgttaccgagatagtggaggtcgatcgcgacgtgcggatcataatattcgccaag
cggaaaatctatcgcggcgaggagctctcgtacgattacaagttcgacattgaggacgag
tcgcacaagataccgtgcgcctgtggagcgcccaactgccgcaagtggatgaactag

DBGET integrated database retrieval system