KEGG   Drosophila sechellia: Dsec_GM18996Help
Entry
Dsec_GM18996      CDS       T01064                                 

Definition
GM18996 gene product from transcript GM18996-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dse  Drosophila sechellia
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dsec_GM18996
  Lipid metabolism
   00062 Fatty acid elongation
    Dsec_GM18996
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsec_GM18996
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dsec_GM18996
Lipid biosynthesis proteins [BR:dse01004]
 Fatty acid synthase
  Component type
   Dsec_GM18996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 288 aa AA seqDB search
MRLRLQVLVALVTCSSITGSLAYKPVVILHGILSGAESMASLVREIKEFHPGTIVYNCDK
FSGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFI
SLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLLYSEF
LPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIRR
PIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagacttcgtttgcaagtcctggtggccctggtaacctgctcgtccattaccggctca
ctggcctacaaaccggtggtcattctccatggaattctatccggagccgaatcgatggcc
tctctggtccgggaaatcaaagagtttcatcctggtaccatcgtctacaactgcgacaag
ttcagtggatggtacagcttggagaacgcctggcgacaagtcgatcaggtcagggattac
ctcaatgaggtaggcaaactgcatccagagggcatcattgtgctgggttactcgcaagga
gggctcctggcccgggcggccatccaaagtctgcccgagcacaatgtgaagacctttata
tctctatcctcgccacaggcggggcaatacggcactagcttcctgcatctgatatttccc
gatttggcagccaagacagccttcgagttgttctactcgcgcgtgggacagcacacctcg
gttggtggctactggaacgatccgcagaggcaggatctctatctgctgtacagcgaattc
ttgccactgatcaataatgagaagaagacctccaactccacttccttcaagatgggaatg
gtgcggctgaataagttggtgatgatcggcggacccaacgacgatgtgattacaccgtgg
caatcgagccactttgggtacttcgacgagaacatggatgtgattccttttattaggcga
ccgattttcaccagcgactccattggcatcaggacgcttcaggaggccggcaagctcatc
attgtggtcaaaccccatgttcatcatcttgcctggcacacgcgaagggatgtcatccac
gaagtgatatttccatatctggactga

DBGET integrated database retrieval system