KEGG   Drosophila sechellia: Dsec_GM19073Help
Entry
Dsec_GM19073      CDS       T01064                                 

Definition
GM19073 gene product from transcript GM19073-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dse  Drosophila sechellia
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dsec_GM19073
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dsec_GM19073
Enzymes [BR:dse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dsec_GM19073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MWWSRKFVSRSLRLHRLKSTRSTAPRKPEQSLGIIGVPFAKGQAKLGVELAPDLLRQSSL
RQVLQSSHDDLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLV
ENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLL
EQLRNTWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVP
KIIEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTERVQ
GVDLVEINPKLGSERDVRTTVESGLEILKSMFGYRRSGRWSNIDTGILGSD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagccgtaaatttgtctcaaggtctctccgcctccaccggctcaagagcacc
agaagcactgcgcccaggaaaccggagcaatctctaggcatcattggagtgcccttcgca
aaggggcaggccaagctgggcgtggaactggcgccagatcttctccggcagagcagtctg
cgtcaggtgcttcagagcagtcatgatgacctggtgatacgggactacggaaatctgcag
tacgccgtagacgagccccttctccagcagcagcgtgtgcactatcaccacatccgaaac
tacgcggacttcatggcctgcaatcgggcactgattgaacaggtgaaactcatgctcgtg
gaaaacacgcagtttttggccattggtggtgatcatgcgatcggcttcggatccgtggcc
gggcacctgcaacatacgccgaatttgtccctggtgtggatcgacgcacatgcggacatc
aatctgcatagcacctcgcagtcgggcaacatccatgggatgcccgtatcatttctgttg
gagcagctccgtaacacctggcagcacgctggcctacaggaaatcgcgcccaactgcttg
cccaaggatcagctggtttacatcggactccgggacattgacccctacgaggcgttcatc
ctaaacaaagtcggaatacgctactatgcaatggataccatcgaccgggtgggcgtgccc
aagattatcgagatgacgctggacgcccttaatccgcagaacaagatccacgtcagcttt
gacatcgatgccttggacagcaatgtggcacctagcacgggcactgcggtacgcggtggc
ctcacgctccgcgagggaatcagcatcgtggaggcactccgggacaccgagcgggtgcag
ggcgtcgatctggtggagatcaacccaaagctaggcagcgagcgcgacgtgcgcaccact
gtggagtccggcctggagatactaaagagcatgttcggttaccggcgttccgggcgctgg
agcaacatcgatactggaatccttggcagcgattaa

DBGET integrated database retrieval system