KEGG   Drosophila sechellia: Dsec_GM19073Help
Entry
Dsec_GM19073      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM19073-PA
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dse  Drosophila sechellia
Pathway
dse00220  Arginine biosynthesis
dse00330  Arginine and proline metabolism
dse01100  Metabolic pathways
dse01230  Biosynthesis of amino acids
Module
dse_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Dsec_GM19073
   00330 Arginine and proline metabolism
    Dsec_GM19073
Enzymes [BR:dse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dsec_GM19073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 6615870
NCBI-ProteinID: XP_002040240
FlyBase: FBgn0173975
UniProt: B4I930
AA seq 351 aa AA seqDB search
MWWSRKFVSRSLRLHRLKSTRSTAPRKPEQSLGIIGVPFAKGQAKLGVELAPDLLRQSSL
RQVLQSSHDDLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLV
ENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLL
EQLRNTWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVP
KIIEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTERVQ
GVDLVEINPKLGSERDVRTTVESGLEILKSMFGYRRSGRWSNIDTGILGSD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagccgtaaatttgtctcaaggtctctccgcctccaccggctcaagagcacc
agaagcactgcgcccaggaaaccggagcaatctctaggcatcattggagtgcccttcgca
aaggggcaggccaagctgggcgtggaactggcgccagatcttctccggcagagcagtctg
cgtcaggtgcttcagagcagtcatgatgacctggtgatacgggactacggaaatctgcag
tacgccgtagacgagccccttctccagcagcagcgtgtgcactatcaccacatccgaaac
tacgcggacttcatggcctgcaatcgggcactgattgaacaggtgaaactcatgctcgtg
gaaaacacgcagtttttggccattggtggtgatcatgcgatcggcttcggatccgtggcc
gggcacctgcaacatacgccgaatttgtccctggtgtggatcgacgcacatgcggacatc
aatctgcatagcacctcgcagtcgggcaacatccatgggatgcccgtatcatttctgttg
gagcagctccgtaacacctggcagcacgctggcctacaggaaatcgcgcccaactgcttg
cccaaggatcagctggtttacatcggactccgggacattgacccctacgaggcgttcatc
ctaaacaaagtcggaatacgctactatgcaatggataccatcgaccgggtgggcgtgccc
aagattatcgagatgacgctggacgcccttaatccgcagaacaagatccacgtcagcttt
gacatcgatgccttggacagcaatgtggcacctagcacgggcactgcggtacgcggtggc
ctcacgctccgcgagggaatcagcatcgtggaggcactccgggacaccgagcgggtgcag
ggcgtcgatctggtggagatcaacccaaagctaggcagcgagcgcgacgtgcgcaccact
gtggagtccggcctggagatactaaagagcatgttcggttaccggcgttccgggcgctgg
agcaacatcgatactggaatccttggcagcgattaa

DBGET integrated database retrieval system