KEGG   Drosophila sechellia: Dsec_GM19077Help
Entry
Dsec_GM19077      CDS       T01064                                 

Definition
GM19077 gene product from transcript GM19077-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dse  Drosophila sechellia
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dsec_GM19077
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dsec_GM19077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 304 aa AA seqDB search
MAETEVLVFGSAIIDFISYTTRLPKAGETLHGHRFQTGYGGKGANQCVAAARQGSRTALV
AKLGADTFGSDYLRHLREEHVNVNHVEQLAEQTTGVAQIAVSDGGENNIIIVVGANNRLS
SCDVSSAEALFQEAKVLVCQLETPVEATLTALRTFRGVSIVNAAPAMTDTPPELLQLANI
FCVNESEAALMTQMPDICNVEQAEDAVGKLIAAGANTVIITLGKLGAVFGSADSKGVCQH
VAAPNVAPEKVVDTTGAGDAFIGALAHHLARHPKGKLEEHIAAACAVASQSVQLPGTQSS
FPRA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaacggaagtgctggtattcggctcggccatcattgactttataagctacacg
acccgtctgccgaaagccggagaaacgctccatgggcatcgcttccagactggctacggc
ggcaagggcgccaatcagtgtgtggctgccgcgcgccaaggatcccgcacagctctggtg
gccaaactgggcgcagacaccttcggcagcgactatttgcggcatctgcgcgaggagcac
gtcaatgtcaaccacgtcgagcagctggcggagcagacgactggcgtggcccagatagcc
gtgtcagatggcggcgagaacaacatcatcattgtggtgggcgccaacaatcggctgagc
tcgtgtgacgtttcctcggcggaggcgctcttccaggaagccaaagttctggtgtgccag
ctggagacgccggttgaggccaccctgaccgctctgagaaccttccggggcgtgtccatt
gtcaacgcggctccggccatgaccgacacaccccccgaactgctacagttggccaacatc
ttctgtgtgaacgaaagcgaggcggctttgatgactcagatgcccgacatttgcaacgta
gagcaagccgaagatgcggttggaaagctgatagcggcaggtgccaacacggtgatcata
actctgggcaaactaggagctgtattcggctccgccgactccaagggcgtgtgccagcat
gtggctgcgccaaatgtggcgcccgaaaaagtggtggacacgacgggggctggcgacgcc
ttcattggggccttggcccaccacttggcccgtcatccaaaggggaaactggaggagcac
atagctgccgcctgtgccgtggcctcgcaatccgtccagctacctgggacgcagtcgagc
ttcccacgcgcttag

DBGET integrated database retrieval system