KEGG   Drosophila sechellia: Dsec_GM19132Help
Entry
Dsec_GM19132      CDS       T01064                                 

Definition
GM19132 gene product from transcript GM19132-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dse  Drosophila sechellia
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsec_GM19132
   04150 mTOR signaling pathway
    Dsec_GM19132
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dsec_GM19132
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dsec_GM19132
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dsec_GM19132
Mitochondrial biogenesis [BR:dse03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dsec_GM19132
  Mitophagy factors
   Other mitophagy factors
    Dsec_GM19132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 565 aa AA seqDB search
MPQMRAAAAEAVAAGSANGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDLLKRAQHRRDQEARDSNVIDTYAVAEVCTKFGVKET
EVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFFVAGSPPPPPPPPVPQSS
MDHQAPLATVTVGGGTSASSGTATPVPPVAGGTPSSTIPIRPHPERIAPMRDRQLAMSVQ
TSGGGAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRAMKALSYEWKIINPYHVR
VRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNDEVEQGDDVIMESLTPPPLSVSGVM
SLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccccagatgagggctgcggccgctgaggcggtggccgccggcagcgccaatggccag
ccgctagtcaagatcggtcattacctactgggcgccaccctgggcacgggcaccttcggc
aaggtgaagatcggcgagcaccagatcacacgcgtcaaggtggccgtcaagatactcaat
cggcagaagatcaagagcctggatgtcgtgggcaagatccggcgtgaaatccagaaccta
aaactcttccgccatccgcacatcatcaagctgtaccaggtcatatcgacgccgtcggac
atcttcatgatcatggagtacgtgagcggcggggagctgttcgattatattgtgaagcac
ggcaagctgcaggagcaccaagcgcgccgcttctttcagcagattatttctggcgtggat
tattgccaccggcacatgatcgtgcatcgggacctgaagccagagaacctgctgctcgac
cacaacatgcacgtgaagatcgccgacttcgggctctcgaacatgatgctggacggcgag
ttcctgcgcacctcgtgcggctcgcccaactacgctgcccccgaggtgatttccggcaag
ctgtacgccgggccagaggtggacatctggtcgtgcggcgtcatcctgtacgccctgctg
tgcgggacgctgccctttgacgatgagcacgtgcccacgctgttccgcaagatcaagtcg
ggcattttccccattcccgagtacctcaacaaacaagtggtcaatctggtgtgccagatg
ctgcaagtggacctgctcaagcgggcccaacatcgacgagatcaagaagcacgagactcc
aatgtgatcgacacctacgctgtggcagaggtctgcaccaagttcggcgtcaaggagacc
gaggtgcacaactcgctgctcagcggcgatccgcacgatcagctggccatcgcttaccat
ctgatcatcgacaacaaacgcttcgccgacgacgcggccaaccaaataaacgagatcaac
aacttctttgtggccggctctccaccaccgccgccgcctccgcccgttccccaatcatcg
atggaccaccaagcccctctggccaccgtgaccgtgggcggaggcacctcagccagctcg
ggcaccgccacaccagtgccaccagtggctggaggcacgcctagcagcaccatccccatt
cgaccgcatccggagcggattgcgccgatgcgggaccgtcaactggccatgtccgtgcag
acatctggcggcggagccttcccggagaaaaccgcacgtggcggcactcccatcaagcgc
gccaagtggcatctgggcatccggtcgcagagcaagcccaacgacataatgctcgaggta
taccgagcgatgaaggcactcagctacgagtggaagatcattaatccgtaccacgttcgg
gtgcgcaggcagaacgtgaagaccggcaagttctcgaagatgtcactgcagctgtaccag
gtggacgctaagagctatttgctcgacttcaagtcgctgaccaacgacgaggtagagcag
ggcgacgacgtcatcatggagagccttactccgccgccgcttagcgtgtccggggtgatg
tcgctgcagccgaccgggcaccacaccatggagtttttcgaaatgtgcgccgccctgatc
attcaactggctcgctga

DBGET integrated database retrieval system