KEGG   Drosophila sechellia: Dsec_GM19132Help
Entry
Dsec_GM19132      CDS       T01064                                 

Definition
GM19132 gene product from transcript GM19132-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dse  Drosophila sechellia
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dse04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dse04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:dse04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 565 aa AA seqDB search
MPQMRAAAAEAVAAGSANGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDLLKRAQHRRDQEARDSNVIDTYAVAEVCTKFGVKET
EVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFFVAGSPPPPPPPPVPQSS
MDHQAPLATVTVGGGTSASSGTATPVPPVAGGTPSSTIPIRPHPERIAPMRDRQLAMSVQ
TSGGGAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRAMKALSYEWKIINPYHVR
VRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNDEVEQGDDVIMESLTPPPLSVSGVM
SLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccccagatgagggctgcggccgctgaggcggtggccgccggcagcgccaatggccag
ccgctagtcaagatcggtcattacctactgggcgccaccctgggcacgggcaccttcggc
aaggtgaagatcggcgagcaccagatcacacgcgtcaaggtggccgtcaagatactcaat
cggcagaagatcaagagcctggatgtcgtgggcaagatccggcgtgaaatccagaaccta
aaactcttccgccatccgcacatcatcaagctgtaccaggtcatatcgacgccgtcggac
atcttcatgatcatggagtacgtgagcggcggggagctgttcgattatattgtgaagcac
ggcaagctgcaggagcaccaagcgcgccgcttctttcagcagattatttctggcgtggat
tattgccaccggcacatgatcgtgcatcgggacctgaagccagagaacctgctgctcgac
cacaacatgcacgtgaagatcgccgacttcgggctctcgaacatgatgctggacggcgag
ttcctgcgcacctcgtgcggctcgcccaactacgctgcccccgaggtgatttccggcaag
ctgtacgccgggccagaggtggacatctggtcgtgcggcgtcatcctgtacgccctgctg
tgcgggacgctgccctttgacgatgagcacgtgcccacgctgttccgcaagatcaagtcg
ggcattttccccattcccgagtacctcaacaaacaagtggtcaatctggtgtgccagatg
ctgcaagtggacctgctcaagcgggcccaacatcgacgagatcaagaagcacgagactcc
aatgtgatcgacacctacgctgtggcagaggtctgcaccaagttcggcgtcaaggagacc
gaggtgcacaactcgctgctcagcggcgatccgcacgatcagctggccatcgcttaccat
ctgatcatcgacaacaaacgcttcgccgacgacgcggccaaccaaataaacgagatcaac
aacttctttgtggccggctctccaccaccgccgccgcctccgcccgttccccaatcatcg
atggaccaccaagcccctctggccaccgtgaccgtgggcggaggcacctcagccagctcg
ggcaccgccacaccagtgccaccagtggctggaggcacgcctagcagcaccatccccatt
cgaccgcatccggagcggattgcgccgatgcgggaccgtcaactggccatgtccgtgcag
acatctggcggcggagccttcccggagaaaaccgcacgtggcggcactcccatcaagcgc
gccaagtggcatctgggcatccggtcgcagagcaagcccaacgacataatgctcgaggta
taccgagcgatgaaggcactcagctacgagtggaagatcattaatccgtaccacgttcgg
gtgcgcaggcagaacgtgaagaccggcaagttctcgaagatgtcactgcagctgtaccag
gtggacgctaagagctatttgctcgacttcaagtcgctgaccaacgacgaggtagagcag
ggcgacgacgtcatcatggagagccttactccgccgccgcttagcgtgtccggggtgatg
tcgctgcagccgaccgggcaccacaccatggagtttttcgaaatgtgcgccgccctgatc
attcaactggctcgctga

DBGET integrated database retrieval system