KEGG   Drosophila sechellia: Dsec_GM19481Help
Entry
Dsec_GM19481      CDS       T01064                                 

Definition
GM19481 gene product from transcript GM19481-RA
Orthology
K15293  
protein unc-13
Organism
dse  Drosophila sechellia
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1455 aa AA seqDB search
MMNTSQLQVTGNPEKKSQLLKKELMINTQEKLIFAENALKSQIKIKEQLRLQQQSTIYAS
SLLSSSAAGSVKAPLSNQKHLNSIQHNMDFNLAQTQMPQMQPPMSKSPIGLDFSYLSYPS
TNTNESMISIKSEEQLCQIYNSEQHSDYIISDYMDKIATRISLLETELKFAWRALDLLST
EYGKIWIRLEKLENISIEQQSVVGNLVDLIGASKQELQEVDIERMKVPLYQDEDQLLPLE
MEDTLDIDIQPSNRDFDKKLTFENHKKTFITKHTQATESEEFMNSACAIDSHPNFENIEF
NGKSLDIGIIQFGFEKGSEPKQKSNQSDFEALKESRIKLYSDSDLMLYERQQFLAHSARA
ELMKEFLNGRRVLNEISASSGALSKSSKKDKNLVKAREPLLSDNSHFEKDDKYMRRPTCE
LESPSSNSFFRIAASRTGEGGNQVLPIEDTGGTESPANINEVDESFYKNLNEAYRDNELS
SAIFKVDALLHQSEATHDQILSIRNQSTSSPVLNNQKGNAITDIQPLQTAKTCIVTQPNQ
HLNKESRKHRKKKHHTNEMDMINKLKCILAQAQSTQIKGDIEELGSNLSDPCVKQTETEN
KTLQNKSDNYSSTSYLKDDIRKMLNNVMQTLLGEITKIKGLQSLSATQMSQLKNAVWSEE
KFFQKISQVDKKLTLLLLNPLTVTEELQRLCILNTNEKFVLVMKKLNKNIDTLKKLVGSS
LDDFKRDNSHANMATFHSLDPSLNSNDSTFSAHLLRNNSNLDEQLKILETQEIEIHRKKK
IDEIVSGLSGETFYPDIEYKRHNSCTNSTDNIIGFSKNIYNEDEYIKSLKKSLERHNSMI
FLLHLQNPEINKVLADISDSQMDSNRASLSPPPPAPTDTVNLNEAINQITYQQRNGKSDS
GLSSMSGWSANSQVSVGLQNFDPTCNNILDNCSERLQTYHSFPLAENSNFHSFPLSYEQA
QTTNQTEFVILEENLNYIYELSKNLPICSAYENKSIFDMKYEISDSNEVSTVDEMLEWDQ
QNEPDKQNISSKRFKTNLMPDLLTAQIPNSTSKHNKNTSVNIEYVRQKENKSMDRRSITE
HHRNIYNGKSENQMCSPCLTDKLVFYPSSNSISDHNSSHDFNCLGQQDQTWIIKEFGSAP
LNQDSTNYLDYTSGSYSKAQPKVLTHETNSSHLEFDHESESLFNSPNTSSYCKQKIVPGT
SPAKPSKVWKRLNTMLADNLKLKRVSKFNRSQSLPGDVQSQGLQRQPRGQAGSCPFISLK
RSNLAGSPVQLSKRIQKLPICFIGRARGAPFVRRLSSPDSALSLDSAADKCFSSEKSFKK
ETLSSKMNSLMQKAKKYKRHSFVLRRGCNMSDSELEMPDFVSSGNYKSSISTREILLNQS
IEVEDEQEDFNYKNGCDFDSKSVLGGSIEKLNGNLTNNLFPIVGDLKKNSKPLTTGCLNR
NFHLMRMKIAINPKI
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacacatctcagctgcaagtgaccgggaatccggaaaaaaaaagtcagttgctt
aaaaaggaactaatgataaacacccaggaaaagcttatctttgcagaaaatgccctcaaa
agccagattaaaataaaggagcagttacgacttcagcaacaatcaacgatttatgcgtcg
tcactattgagctcttctgctgccggatcagtaaaagctccgctctcaaaccaaaagcac
cttaattctatccaacacaacatggattttaaccttgcccaaactcaaatgccgcaaatg
caaccaccgatgagtaagtcgcccattggattggatttctcttatttaagttatccaagc
acaaatactaatgaaagtatgatatcgattaaaagtgaagaacagttgtgtcagatctac
aattcggagcaacactctgactacattatctccgattatatggataaaattgcaacaagg
atcagtttactcgagacagagctaaagtttgcttggcgtgcattggatttgctttctacg
gagtacggaaagatttggattcgtttggagaagcttgaaaacatatcaatagaacagcag
tctgtcgttggaaatcttgtagatcttatcggcgcatcaaaacaagaactgcaagaagta
gatatcgaaagaatgaaagtacccttatatcaagatgaagatcaattactaccgttggaa
atggaagacacattggatatagatatccaaccatctaatcgtgactttgataagaaactt
acttttgaaaatcataaaaaaacttttataacaaaacatacgcaagctactgaatccgaa
gagtttatgaattccgcttgcgcaatagattcccatccaaattttgaaaacattgaattc
aatggcaaaagcttagacattgggataatacaatttgggtttgaaaaaggctccgagcca
aaacaaaaaagtaatcaatcggattttgaagcactcaaggaatcaagaattaaactttac
tcagattctgaccttatgttatatgagaggcagcagtttctagcacatagcgctcgtgcc
gaattaatgaaagaatttttaaatggacgtcgagttttaaatgagatttcggcatcctcg
ggtgcattgtcaaaaagttctaagaaggataaaaatcttgtaaaggctagagaaccactt
ttaagtgacaactcgcattttgagaaagatgataaatacatgagacggccaacctgtgaa
ctggaaagccctagtagtaatagtttttttcgaatagcagcctctagaacaggcgagggt
ggaaatcaggttttacccattgaagacaccggaggaacagaaagtccagctaatattaat
gaagtagacgaatctttttataaaaatctaaatgaggcttatcgtgacaatgaattaagc
tctgcgatatttaaggttgatgcattgctacatcagtctgaggccacacatgaccaaatc
ttatctatccgaaaccagtcaacttcttccccagttttaaataatcagaaggggaatgct
attacagatatacaacctttacagactgcaaagacgtgtatcgtaacgcagccaaaccag
catttgaacaaagaatcaagaaagcatagaaaaaaaaaacatcatacaaacgaaatggat
atgattaataaactaaagtgtattcttgcacaagcacaatcaacacagattaagggagac
attgaagaattgggttcgaatctttcagatccgtgtgttaaacaaactgaaacggaaaat
aaaactctacaaaataaatcagacaactatagtagtaccagctatttaaaagatgatata
agaaaaatgttaaacaacgtaatgcagaccttattgggggaaataactaaaattaaaggc
ttacaatcattgagtgcaacgcaaatgagtcagttaaaaaatgctgtatggtcggaggaa
aagttttttcaaaaaattagccaggttgataaaaagttgactttgctcttacttaatccg
ttaactgttacagaagaactgcaaaggctttgcattttaaacacgaatgaaaagtttgtt
ctggtaatgaagaagttaaacaaaaatattgacacactaaaaaagttagttggcagctca
ttggatgattttaaaagagataattcacatgcaaatatggccacatttcacagccttgat
ccatctcttaattctaatgatagtacttttagtgcacatttattaagaaataactccaat
ctggatgaacaattgaaaattcttgaaactcaagagattgaaatacatcggaaaaagaaa
atagacgaaattgtgagcggactttccggagaaactttttacccagatattgaatataaa
agacataatagttgtaccaactcaactgataatattataggcttctcaaaaaatatttac
aatgaagatgaatatataaagtctttaaaaaagagtctagaacgccacaatagcatgatt
tttttactccatttacaaaatcctgaaataaacaaagtgttggctgatataagtgattca
caaatggattcaaatcgagccagtctcagtcctccaccaccagctccaaccgatacagtt
aacttaaatgaggcaattaatcaaattacatatcaacaacgaaatggaaaatcagactcg
ggcctatcgtcgatgagtggctggtcagccaactcccaagtgtcggttggacttcaaaac
ttcgatcctacatgtaataatattttggataattgtagcgaaagattgcaaacataccat
tcatttcctttggctgaaaattctaactttcacagtttcccactcagttatgaacaagct
caaactactaatcaaactgagtttgtaatattagaagaaaatctgaactatatttatgag
ctttctaaaaatttacctatttgctctgcatatgaaaataaatcgattttcgatatgaaa
tatgaaatttccgattcgaatgaagtatccactgtggacgaaatgctggaatgggaccag
caaaatgaaccggataaacaaaacatttcttcgaaacggttcaaaaccaaccttatgcca
gatctcttgactgcgcaaataccgaattccacatcaaaacacaataaaaacacaagtgtg
aacattgaatatgttagacaaaaagaaaataaaagcatggataggcgtagcatcacagaa
catcatagaaatatttataacggaaaatcggaaaatcaaatgtgcagtccttgtttgaca
gataaactcgtattttatccctcatccaactctatttccgatcacaatagcagccatgat
ttcaattgtttgggtcaacaggatcaaacatggattattaaggaattcggatctgcacct
ttgaatcaagattcaacgaactatcttgattatacttctggttcttattctaaagcgcag
ccaaaggtccttactcacgaaacgaactcaagtcacctggaattcgatcatgaatcagag
tcacttttcaactctcctaatacttctagctattgtaaacaaaagattgttccaggaaca
tctccagcaaagccttcaaaggtatggaaaaggttaaataccatgttagcagataatcta
aagctcaagcgtgtatcaaagtttaatagatcacagtctttacccggtgatgtgcaaagt
caaggcctccagagacagcctcgtggccaggctggttcgtgtccgtttatttccctcaag
cgatccaatctggccggaagcccggttcagttatcgaaaagaattcaaaagcttcccata
tgttttataggacgagcgagaggagcaccattcgtgcggcgtttatcaagcccggactca
gctctttcattagattccgctgccgataaatgcttctcaagcgaaaaaagtttcaaaaaa
gaaacactttcgtccaagatgaatagtttaatgcaaaaggcaaagaagtacaaacggcac
agctttgtcctgcgccgcggctgtaacatgtcggattcggaattagagatgccggacttc
gtttcatcgggtaactataaaagttcaatatcgacaagagaaattttgttgaatcaatcg
atcgaggtagaagatgaacaagaagattttaattataaaaatgggtgtgactttgactct
aaaagtgtgttgggtggttcaattgagaagctaaatggcaacctaacaaataatctattt
cccattgtaggtgacctaaaaaaaaattcaaagccgcttaccactggctgtctcaacaga
aatttccatcttatgaggatgaaaatagcaataaatccgaaaatataa

DBGET integrated database retrieval system