KEGG   Drosophila sechellia: Dsec_GM19676Help
Entry
Dsec_GM19676      CDS       T01064                                 

Definition
GM19676 gene product from transcript GM19676-RA
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1760 aa AA seqDB search
MGTKESKHSNSVSYEDSVKRVSDVELRRLRDAFKKSAGVGRNFLSRNAFQQDVLCEGVPP
KIVDMLYAACGGTQRGISFNDLLCGLVLITRGTQAEKTKFLWNLYCNDAGTFIIKTDYVR
NVNLAPFESVSLFAQSERVNFEQFQDWIIKHRNATVLSKWLLSDNCVSLTSELETPTFYQ
SLAGVTHLEEKDIGDLEKEFWRLKNTSQNGQIDLQFLGPLISPPIPKNALAGLFNAFDEN
RDGHIDFKELCCGVSAACRGPGVERTRFCFKIFDVDRDGVLSHEETLQMINVLLLVAKEN
RESQQYKDLTKQLVISDLLEFGQRRSPDGTPSKLTRDNVSLTAEDFMLWTVQCDLRLMQP
LLDLIFELCHIVFGLWPQCKHMENDIVRGWLRREERRPYRVGQFWYLITHDWWLSWMQYT
QHTAHTCDYCKRTASQRTAVDEALVCDESFNTHSPEQHDSYSLGSGTGSASGSGSASSGI
SAGRHCGPVRPGPIDNSNLITANPFRNVRTLTGEGGHLKRDTPLVQNHDFELVPKSLWKA
LNRWYGDNLPLPRQVIQPPNSDVELELYPLNLRILLHQAQPSQTGVGGGTQLGSWGSTVS
GGYGVLASGGGYAAIAASSVLQPPKRYLAYTAAFSRLATVRQVGEFLCEQLRLKSEDIRL
WHVPQLDNGAILLEEDAMCLKELLIRDNDQLLLEIRNKDLTWPEELGSLATAQCGQGAGT
PGDRRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNA
ANKLGTKGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWL
LDALHEDLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSC
LGCGHESVRFDPFSLLSLPLPVENYVYFEVLVILLDGSVPIKYGFRLNSDCKYSHLKHKL
STMCSLPPNLMLVCELWNSQIRQVLNDDEKLRTQSAKELYVYQLPEQSVRTRSNSGLSMH
IEQGLKDIQRSSALITSAQDSLSSLSTLQTSSNRASSRVLCNGHVSGLEVEGDTEVGTDV
SQCNSNSNYNPIVSTYSGNGSGDNQVHELLPDEAGKESLILSSSPENTFMHGAAAQQKRV
SSAKLLHTESNTSSMSYTNHSGENSMESSLTEPIPLADLEPVSSRNGSGSEDCSYRTSPN
DSSGLSTGHTLGASLDVDEQAEEGNADEQDQPDQITTSQPETSSGVYSRRSSQPPHKAGK
YLVAVHRKITRHDSYFLSYHKTRPSLFGVPLLIPNSEGGTHKDLYCAVWLQVSRLLSPLP
ATTEQANHAADCDDSLGYDFPFTLRAVKADGLTCAICPWSSFCRGCEIRCNNDYVLQGAL
PPINAAASNTSTPKMNAKFPSLPNLEAKRTPEYTASLSYTPTTKYFEDFTIAIDWDPTAL
HLRYQSTLERLWVDHETIAISRREQVEPVDLNHCLRAFTSEEKLEQWYHCSHCKGKKRAT
KKLQIWKLPPILIVHLKRFNCVNGKWVKSQKVVHFPFDDFDPTPYLASVPQETILRHKEL
LELKKDAEMTMATNEVVSELDEIDAPSKEDKEELPNQTGSTKATASPPPTGNILRQSKTK
NAVRRQRLISTSLTKTPIVDGEFEDYHQHRLKPDVDEFDPRYRLYAVVSHSGMLNGGHYI
SYASNATGSWYCYNDSSCREISQKPVIDPSAAYLLFYERKGLDYEPYLPNIEGRTLPNTA
SVPLEVDETEGELKKLCSIS
NT seq 5283 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccaaggagtccaagcactccaatagcgtcagctacgaggattcggtgaagcgc
gtaagcgacgtggagcttcgccgcctgagagatgccttcaaaaagtcagcgggcgtgggc
aggaacttcctcagtcggaatgcctttcagcaggatgtgctgtgcgagggagtgccgcca
aagatcgtggacatgttatatgccgcctgtggtggcacccagcgtggcatctccttcaac
gacctgctctgcggtctggtcctgataactcgtggtacccaagcggagaaaaccaaattc
ctgtggaacctctactgcaacgatgctggcaccttcatcatcaagacggactatgtacgc
aacgtcaatctggctcccttcgagagcgtctccctattcgcgcaaagcgaacgcgtcaat
ttcgagcagttccaggactggatcataaagcatcgcaatgccacggtcctctccaaatgg
ctgctgtccgacaactgtgttagcctcacttcggagctggagacgccaacgttctaccag
agcctcgctggagtgacgcatcttgaggagaaggacattggcgatttggaaaaggagttt
tggcgtttgaaaaacacttcccaaaatggccaaatcgacttgcagttcctgggaccgctg
atcagcccacccataccaaagaatgctctagcaggtctattcaacgcctttgatgagaac
cgggatggacacatcgactttaaggagttgtgttgcggagtaagtgccgcctgccgagga
ccgggtgttgaaaggacacgattttgcttcaaaatcttcgatgtggatcgagatggcgtt
cttagtcacgaggaaacactgcagatgatcaatgttctgctattagtggccaaggaaaat
cgggagtcccagcaatacaaggatctgaccaaacagctggtgataagtgatctactagag
tttggacagagaagaagtccggatggaacgcctagtaagctaacccgagacaatgtctcg
ctgaccgctgaggattttatgctgtggaccgtacagtgtgatctgagactcatgcagccc
ttgctggacctcatcttcgagctttgccacatcgtctttggcctgtggccccagtgcaag
cacatggagaacgatattgtccggggatggctgcgacgggaggagcgcaggccgtaccgc
gtgggacagttttggtacttgatcacgcatgactggtggctcagttggatgcaatacact
cagcacacggcgcacacctgcgactattgcaagcgcaccgccagtcagcggacagctgtt
gatgaggcactcgtctgcgatgagagctttaacacccacagcccggaacagcacgacagc
tactccctgggttccggcacgggatcggcttccggttccgggtcggcgagtagtggcatc
tcagctggacggcattgcggacctgtgcgaccagggcctattgacaacagcaacctgatc
accgccaatccgttccggaatgttcggacactcaccggcgagggtggtcacctcaagcgg
gacacaccgctggtgcagaaccacgactttgaactggtgcccaagtcactgtggaaggca
ttgaatcgatggtatggcgacaaccttccactgccacgacaggtcatccaaccacccaac
tccgatgtggaactggagctatacccgctgaaccttcgaatcctgctccaccaggcgcag
ccatcccagacaggcgtaggcggaggcactcaacttggtagctggggctccacggtgagc
ggtggctacggagtgctggcctcaggaggcggatatgccgccatcgcagcgagcagtgta
ctccaaccgccgaagcgatacttggcctacacggccgccttcagccgactggccacggtg
cgccaggtgggcgagtttttgtgcgagcaactgcgtcttaagtcagaggatatccggctg
tggcacgttccacagctggacaacggtgccatactgctagaagaggatgccatgtgcctg
aaagagctgctcattcgggacaatgaccagctgttgctggaaatccgcaacaaagatttg
acctggccggaggaacttggctccttggccaccgctcaatgtggccagggtgcgggaaca
ccgggcgaccggcgtcgcttaacacgcagttcaattatgtcggttcatgcccccggagcc
acaggcctgcacaacctgggcaacacctgcttcatgaacgccgctctccaggtgctgttt
aatacccaaccactggcacaatactttcagcgagagatgcaccgcttcgaggtgaacgcg
gccaacaaactgggcacaaagggccagctagccatgcgctatgcggagctgcttaaggag
gtttggacggccacgactagatctgttgcgccgctcaagctacgcttttgcgtcaacaag
tatgcgccgcagttcgccggtggaggtcagcacgattcccaggagctgctggagtggctg
ttggacgctctgcatgaagacctgaaccgggtgatggagaagccgtacagcgaactaaag
gactcgaatgggcgcccagacaaaatagtggccgccgaggcgtggtcccagcaccacgcc
cgaaaccagtcaattatcattgatctgttctacggccagttgaaatccaaggtcagctgt
ctgggttgtggacacgaatcggtgcgattcgatccctttagtctgctcagtttgccgctt
ccggtagagaattatgtctactttgaggtcttggtaattctgttggatggaagcgttcca
atcaaatatggttttcgcctgaactccgattgcaagtactcgcacctgaaacacaagttg
tccactatgtgctccctgccgccaaatctaatgctcgtctgcgagctatggaactcacaa
atacgccaggtgctgaacgacgacgagaaactgcggacgcagagtgccaaggagctgtac
gtctatcagctgccggaacaaagtgtgcgaacccgatccaactcaggtctcagcatgcac
atcgagcagggtcttaaggacatacagcgcagttccgctctgatcacgagcgcccaggac
tcgctgtcctcgctgagcactttgcagacgtccagcaaccgcgcctcgtcacgagtcctt
tgcaacggccacgtttctggcctggaggtcgaaggcgatacggaggtgggcacggatgtg
tcgcaatgcaacagcaacagcaattacaatcctatcgtaagcacttacagcggaaacgga
agcggggacaaccaggtgcacgaactgctgccagatgaggccggaaaggagtcgctaatc
ctgagctccagtccggagaacacatttatgcacggcgctgccgcccagcagaagcgcgta
tcgtccgccaaactgctgcacacggagagtaacaccagctccatgtcctacacgaatcat
tccggcgaaaattccatggagagctcgctgaccgaacctattccattggcggacctggag
ccggttagcagccgtaatggcagtggcagcgaggactgctcctaccggacgtcgccaaac
gattccagtggcctcagcacgggccacaccctgggcgccagtttggacgtggacgagcag
gcggaagagggcaacgcggatgagcaggatcagccggatcagatcactacctcgcagccg
gagaccagtagcggggtctactctcgtcgctcctcccagccgccgcacaaggcgggaaag
tatttggtagccgtgcatcgaaagataacgcggcacgacagctacttcctttcctaccac
aagacgaggccaagtctctttggcgttccgctgctcattccgaacagcgagggcggcacc
cacaaggatctttattgcgccgtgtggctgcaggtgagcaggctgctgagcccattgcct
gccaccacggaacaggcaaatcatgccgccgattgtgatgacagcctgggctacgatttc
cccttcacgttgcgtgccgtcaaggcagatggactaacctgcgctatttgcccttggtca
agcttctgtcgcggatgcgagattcgctgcaacaatgattatgtactccagggagccctg
ccgcccatcaatgccgccgccagtaatacatcaacgccaaaaatgaatgctaaattccca
tcgctaccaaatctggaggctaaacggacgccggaatacaccgcctccttgtcgtacaca
ccgacaaccaaatactttgaagactttaccattgccatcgattgggatccgaccgccctg
cacttgcgctaccaaagcaccttagagcgtctgtgggtggatcacgagaccattgccata
agtcggcgggagcaagtggagcccgtagacctgaatcattgcctgcgcgccttcacctcc
gaggagaaactggagcagtggtatcactgcagtcattgcaagggcaaaaaacgcgccacc
aagaagctccagatctggaagctacctccaatattgattgtccacttgaagcggtttaac
tgcgtcaacggcaagtgggtgaagtcacagaaagtggtccacttccctttcgatgacttc
gatcctactccgtatctggcctcagtgcctcaggagacgatactgcgacacaaggagctg
ctggagctaaagaaggatgcagaaatgacgatggcaaccaacgaagttgttagcgaattg
gacgagattgatgcccctagtaaggaggataaggaagaactccccaatcaaacggggtca
acaaaggctacggcttcaccaccgcccacagggaatattctgcgccagagcaagaccaaa
aatgctgtccgacgacaacgcctcatatcgacgagtctcaccaaaacgcccatcgtggat
ggcgagttcgaagactatcaccaacaccgacttaaaccagatgtggatgagttcgatccc
agataccgactctatgctgttgtgtctcactcgggcatgctgaacggaggtcactacatt
tcctatgcatcgaatgcaactggttcctggtactgctacaacgacagctcctgccgcgaa
atatcccagaagccggtcatcgatccaagtgctgcatatctgctgttctacgaacgcaag
ggcctggactacgagccgtacctaccgaacatcgagggacggacgctgcccaataccgcc
agtgtgccactcgaggtggacgagaccgagggagagctgaagaagctgtgctcaatttcc
taa

DBGET integrated database retrieval system