KEGG   Drosophila sechellia: Dsec_GM19853Help
Entry
Dsec_GM19853      CDS       T01064                                 

Definition
GM19853 gene product from transcript GM19853-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dse  Drosophila sechellia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dsec_GM19853
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dsec_GM19853
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dsec_GM19853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 193 aa AA seqDB search
MFDKETLFPGLLAAVALVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFGNPVQLDTFAG
HVMLIVNIASRCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHL
RREGANIGHLFAKIDVKGAQADPLYKLLTRHQHDIEWNFVKFLVDRKGNIHKRYGAELEP
VALTDDIELLLGR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataaagaaactcttttcccaggccttttggctgcagtggccttggtggtagta
ctacaaacacgcagcagattgcagcaggatttgcaggatatgcgatggcgtctaacgata
cacgctctcaccgttcgagatacctttgggaatccagtgcaactcgatacattcgccggc
catgtgatgctcatcgtcaacattgcctccagatgcggacttaccttatctcagtacaac
ggtttacgatatttactagaggaatatgaggaccagggcctgagaattttaaactttccc
tgtaaccaatttgggggtcaaatgcccgagtccgatggccaggagatgttggatcacctg
cgcagggagggagccaacataggacacctcttcgccaagatagatgttaaaggagcccag
gcagatccgctgtacaagctcctaacgcgccaccagcatgatatcgagtggaattttgtc
aagtttctggtggatcgaaagggaaacatacacaagagatatggcgccgaactggaacca
gttgccctgaccgatgacatagagctgctgctcggcagatga

DBGET integrated database retrieval system