KEGG   Drosophila sechellia: Dsec_GM20062Help
Entry
Dsec_GM20062      CDS       T01064                                 

Definition
GM20062 gene product from transcript GM20062-RA
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
dse  Drosophila sechellia
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dsec_GM20062
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dsec_GM20062
   00600 Sphingolipid metabolism
    Dsec_GM20062
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Dsec_GM20062
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsec_GM20062
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dsec_GM20062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 417 aa AA seqDB search
MYGTWGVFLGGILLLQVLQLSMGLDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKL
FRRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHYQ
GLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFADWDVDYVKLDGCYANISDMATGYPEFG
RLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQHCNMWRNWDDIEDSLESLMQIMDYFA
KNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLAAVRPEI
KAILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTRSGHHSYAVAFVSRRDDGA
PYRIPFTVKEFGLTNPNGYSVQDLYDVSNKLGIFQSESQFITRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaacgtggggcgtctttctgggcgggattctcctgctgcaggttctgcaatta
tccatgggcctcgataatggcctggcactaaagccacctatgggctggatgtcctgggaa
cgcttccgttgcattaccgactgtaaactgtatccggatgagtgcatcagtgaaaaacta
ttccgaagacatgcggatcttctggtttctgaaggatatgcggatgctggctacgagtac
gtcatcatagatgactgctggctggagaagaatcgcgacaacgatacccagaagctggtt
ccggacagaaagcgctttcccaacggcctaaatgctttatccgatcatatccactaccag
ggtctgaagtttggcttgtaccaggattacggcaccaacacctgcgctggctatcccgga
gtgatcaagcacatgaagctggacgcccagacctttgcggattgggacgtggactacgtg
aagctggacggctgctatgcgaatatcagcgacatggccacgggctatccggagttcgga
cgcctgctcaatgaaactggtcgtccgatggtgtactcctgcagttggcccgcgtatcag
gaggatgcaggagaaatgcccgactatgagtcactcaagcagcactgtaatatgtggcgc
aactgggacgacatcgaagactcgctcgagtccctcatgcagatcatggactactttgct
aagaatcaggacaggattcagccgcatggcggaccaggacactggaacgatcccgatatg
ctgctgttgggaaactacggcttgagttacgatcaaagcaagctgcagatggccatttgg
gccattatggcggcacctctaattatgtccaatgatctggctgcagttcgtcccgagatc
aaggctatactgcagaatcgtgcggttattgctgtggaccaggatgagctgggaatccag
ggccgtcgtgttttgtcccgcaaccaaatcgaagtctggaaacgtcccattacgccagta
accaggagtggacatcactcctatgccgtcgccttcgtcagtcgccgagatgatggcgct
ccctacaggatccccttcacggtcaaggagttcggactgacgaatccaaatggttatagt
gtgcaggatctatacgatgtcagcaacaagttgggcatcttccagtcggagagtcagttc
atcacacgcgtcaatcccaatggcgtaactttctacaagtttacagcgttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system