KEGG   Drosophila sechellia: Dsec_GM20343Help
Entry
Dsec_GM20343      CDS       T01064                                 

Definition
GM20343 gene product from transcript GM20343-RA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dse  Drosophila sechellia
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dsec_GM20343
   00330 Arginine and proline metabolism
    Dsec_GM20343
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dsec_GM20343
Enzymes [BR:dse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Dsec_GM20343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 716 aa AA seqDB search
MLKGVPTLAGRNLRLLTTQAQVLVHQRAKASAVEPVEDFDQDTDLLKRAKFGHTGKQLQQ
KIINEKKLRAPPLMNLVFANRKLSFYDTSSTPKTKEDNAKLSQRRHYSMRPHREQEQRNA
EDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAE
TQHLNRDTFKAVVAPNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIP
QLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQ
EPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSG
GEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAM
SVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGG
MMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRKHRY
ETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECVKFLLE
QCHVPHNPKDRWGNLPVDEAENFGHSHVVEFLRSWAEKADQSSEECKPEAVTSKTQADEE
ICSTSDLETSPTTSPIPTPVESGSRPGSGRSSPVPSDAGSTASAGSSIDDKTKPGL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaggtgttcccacgctagccggtcgaaaccttcgtctcctgacgacccaggca
caggtgctggtccatcaacgcgccaaggcgtccgccgtcgagcccgtcgaggatttcgac
caggatacggatctcttgaagcgcgccaagttcggacacacgggcaaacagctgcagcag
aaaataatcaatgagaaaaaactgcgcgctccaccgcttatgaacttggtgtttgctaat
cggaagttgtccttctacgataccagttccacgcccaagaccaaagaggataatgccaag
ctcagtcagagacgccactattcgatgcggccccatcgcgagcaggagcagcgaaatgcg
gaggatgtgctattcgacatgttcgccagcgaggagacgggcctcatctcgatgggcaag
ttcctggccgggctgaagaccaccggtattcgccggaacgatccgcgagtgcgagaactg
atggacaacttgaagaaagtgcacaagctaaataactacgagacgggttcttcggcggaa
actcagcatctcaatcgggataccttcaaggctgtggtggcccccaatattgtgctgatt
gccaaggccttccggcagcagttcgtgatccccgactttacgagtttcgtgaaggacatc
gaggacatttacaatcgctgcaagaccaacactttgggcaagttggccgactacattccc
cagctggcgcgctacaatcccgattcctggggcctgagcatctgcaccattgatggtcag
cgcttctccatcggtgatgtggatgtgcccttcacactccagagttgcagcaagccactg
acctacgccattgccctggagaaactgggtcccaaggtcgtacactcgtatgtgggacag
gagccgagtggcaggaacttcaacgaactggtcctggatcagaacaaaaagccacacaat
ccaatgatcaacgctggtgccattctgacctgctccctgatgaatgccctggtcaagccg
gacatgacctccgctgagatcttcgactacaccatgtcctggttcaagcggctgtccggc
ggggagtatatcggctttaataacgccgtattcctgtccgaacgcgaggctgccgatagg
aactacgccctgggcttctacatgcgggaaaacaagtgcttccccaagcgcaccaatctt
aaggaggtgatggacttctacttccagtgctgctccatggagaccaactgcgaagcaatg
tccgtgatcgcggccagtttggccaatggtggcatctgccccaccaccgaggagaaggtg
ttccggccggaggtaatccgggatgtgctctcgatcatgcactcatgcggcacatacgac
tactccggacagttcgccttcaaggtgggtctgccagccaagtctggagtgagtggcggc
atgatgctggtcatccccaacgtaatgggcatctttgcctggtccccgcccttggatcac
ttgggtaatacagtgagaggactacagttttgtgaggagctggtctccatgttcaatttc
catcgctacgacaacctgaagcatctgtccaacaagaaggatccgcgaaagcatcgctac
gagaccaagggtctgtccatcgtgaatctgctcttttcagctgccagcggcgatgttacg
gccttgcggcgtcatcgtctctccggaatggatatcaccctggccgactacgatggtcgc
actgccctccatttggctgcctccgagggacacttggagtgcgtcaagttcctgctggaa
cagtgtcatgtaccccacaaccccaaggatcgctggggaaatctgcccgtggatgaggca
gagaacttcggccacagccacgtggtggagttccttcgctcctgggcggagaaggccgac
cagtccagcgaggagtgcaagccagaggctgtgaccagcaagacacaagcggatgaggaa
atctgcagcacaagcgacctggagaccagtccgacaaccagtcccattcccactcccgtg
gaatccggatctaggccaggatcaggacgttccagcccggtgccatcggatgcgggcagc
acggcgagcgccggcagcagcatcgatgacaaaaccaagccgggactataa

DBGET integrated database retrieval system