KEGG   Drosophila sechellia: Dsec_GM20356Help
Entry
Dsec_GM20356      CDS       T01064                                 

Definition
GM20356 gene product from transcript GM20356-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dse  Drosophila sechellia
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dsec_GM20356
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dsec_GM20356
   00603 Glycosphingolipid biosynthesis - globo series
    Dsec_GM20356
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dsec_GM20356
   00511 Other glycan degradation
    Dsec_GM20356
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsec_GM20356
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dsec_GM20356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 673 aa AA seqDB search
MRYVYESLRYLYKMSLAVSLRRALLVLLTGAIFILTVLYWNQGVTKAQAYNEALERPHSH
HDASGFPIPVEKSWTYKCENDRCMRVGHHGKSAKRVSFISCSMTCGDVNIWPHPTQKFLL
SSQTHSFSVEDVQLHVDTAHRDVRKQLQLAFDWFLKDLRQIQRLDYVGSSSEPTVSESSS
KSRHHADLEPAATLFGATFGVKKAGDLTSVQVKISVLKSGDLNFSLDNDETYQLSTQTEG
HRLQVEITANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSR
HFFSVESIKRTIVGMGLAKMNRFHWHLTDAQSFPYISRYYPELAEHGAYSESETYSEQDI
REVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQPWSFYCGEPPCGQL
NPKNNYTYLILQRLYEELLQHTGPTDFFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQA
MVRLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFS
HVDAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTE
QVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEAL
FPKYCAQNPGECI
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgtatacgaaagcctacgctatctctataagatgtccttggctgtatcgctg
cgccgagctctgttggtgctgctcaccggcgccatattcatcctgacggtgctgtactgg
aaccaaggagtcaccaaggcccaggcttacaatgaggcgctggaacgcccccacagccat
cacgatgccagtggctttcctatacccgtcgagaagtcctggacgtacaagtgcgagaat
gaccgatgcatgcgggtgggccaccatggtaaatccgccaagagggtctcgttcatcagc
tgttcgatgacgtgtggtgacgttaacatttggccgcaccccacccagaaattcctgctc
agctcccagacgcacagcttctccgtcgaggatgtgcagctgcacgtggacacggcgcat
cgcgacgtacgcaagcagctccaactggcttttgactggttccttaaggatctcaggcaa
atccagcggctggactacgtgggtagttcatctgagccgaccgtaagcgagtcctcatcg
aaatcacgccaccacgcggatttggaaccagctgccacgctctttggagctacctttggt
gtaaagaaggctggcgatctaactagtgtacaggtcaagatcagcgtgctcaagtccgga
gatcttaactttagcctggacaatgacgaaacctaccagcttagcacacaaaccgaagga
caccgcctgcaggtggagatcaccgcaaactcttacttcggagcccgtcacggactgtct
acgctgcagcaactgatatggtttgacgacgaagatcatctgctgcatacgtatgccaat
agcaaggttaaggatgcgcccaagttccggtatcgaggcctcatgctggacacctctcgc
cacttcttctctgtggagtcaatcaagcgtacgattgtgggcatgggcctggccaagatg
aaccgcttccactggcacctcacagatgcccagagtttcccctacatttcgcgctactat
ccagagttggccgagcacggagcttactcggagagcgagacatactccgagcaagatatt
cgcgaggtggccgagttcgccaagatctatggcgttcaggtcatacccgagatcgatgcg
cctgcccatgcgggcaatggctgggattggggacccaagcgcggaatgggcgagctggcc
atgtgcatcaaccagcagccatggagcttctactgtggcgaaccgccgtgcggccagctg
aatccgaagaataactatacctacctcattctgcagcgcctctacgaggagttgttgcaa
cacacgggccccacagacttcttccacctgggcggtgacgaggtgaatcttgattgctgg
gcgcaatacttcaatgatacagatctccgcggattgtggtgcgatttcatgctccaggct
atggtcagactaaaactggccaacaatggagtagcgcccaagcacgtggcagtctggtcg
agcgccctgaccaacaccaagtgtcttccaaacagtcaattcaccgttcaggtatggggc
ggcagcacctggcaggagaactacgatttgctggacaacggctataacgtaatcttctcg
cacgtggacgcctggtatctggactgcggcttcggtagctggcgggccactggggatgct
gcctgtgctccgtaccgcacatggcaaaacgtctacaaacacaggccgtgggagcgcatg
cgattggataagaagcgaaagaagcaggtgctgggtggcgaagtttgcatgtggaccgag
caggtggacgaaaatcagttggacaaccggctgtggccccgtacagccgctctggcggag
cgcttgtggaccgatcctagcgatgatcacgatatggacatagtgccaccagatgttttc
cgcagaatctcactgtttcgaaatcgactcgtcgaactgggcatccgggctgaagcgctg
tttccaaaatactgtgcccagaatcccggcgaatgcatttga

DBGET integrated database retrieval system