KEGG   Drosophila sechellia: Dsec_GM20403Help
Entry
Dsec_GM20403      CDS       T01064                                 

Definition
GM20403 gene product from transcript GM20403-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dse  Drosophila sechellia
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dse04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 488 aa AA seqDB search
MWRLAGVLLLGYIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEY
AKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASG
IAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYR
FGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGH
RTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHE
LNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPES
NDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAEKLQDEDVAIVKM
DATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDRS
GKPKKTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcctcgctggagtgctcctactgggctacatcgccatctcgtccggagcggag
caggatgtcctggaactgggggacgacgacttcgccaccaccctgaaacaacacgagacg
acgctagtcatgttctatgccccctggtgcggccactgcaagcgattgaagcccgagtac
gccaaggcggcggagatcgtgaaagacgatgatccgccaatcaaactggccaaggttgac
tgtacggaagctggaaaggaaacgtgtagcaagtactccgtcagcggctacccaacgctg
aagatcttccgtcaggatgaggtgtcgcaggactacaatggaccacgcgaagccagcggc
attgccaagtacatgcgcgcccaagtgggacccgcctccaagaccgtgcgcaccgttgcc
gagctgaagaagttcctggacaccaaggacaccacgctgtttggctacttcagcgacagc
gactccaagctggccaagattttcctgaagttcgccgataagaaccgcgagaagtaccgc
tttggacattccagcgaaaaggaagtcctcgataagcagggcgaaaccgacaagattgtg
cttattcgtgcgccccatttgagcaacaagttcgagtcatcttctattaagttcgagggt
agctccgagtccgatctgtctacctttgtcaaggagaacttccatggtcttgtgggacac
cgcactcaggattcggtcaaggacttccagaaccccttgatcactgcctactacagcgtg
gactaccagaagaaccccaagggaacgaactactggcgcaaccgtgtgctcaaggtggcc
aaggagtttgtgggtcaaatcaactttgcgatcgcctccaaggatgacttccagcacgag
ttgaacgagtacggctacgatttcgttggcgacaagccagtggtattggctcgcgacgaa
aagaatctcaaatacgccctgaaggacgagttctcagtggagaatctgcaggactttgtc
gagaagctgctggcgaatgagctggagccgtacattaagagtgagcctattcccgagtcg
aacgacgctcccgtcaaggtggccgtcgccaagaacttcgacgatctggttatcaacaac
ggcaaagacacgctgattgagttctacgccccatggtgcggccactgcaagaagctgact
cccatctacgaggagctggccgagaagctgcaggacgaagatgtggccatcgtcaagatg
gatgccaccgccaacgacgtgccgccggagttcaacgtgcgaggctttcccaccctcttc
tggctgcccaaggacgccaagaacaagccagtcagctacaacggaggtcgcgaggtagat
gacttccttaagtacatcgccaaggaggcgaccacagaactgaagggcttcgaccgcagc
ggcaagcccaagaagaccgagctctaa

DBGET integrated database retrieval system