KEGG   Drosophila sechellia: Dsec_GM20403Help
Entry
Dsec_GM20403      CDS       T01064                                 

Definition
GM20403 gene product from transcript GM20403-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dse  Drosophila sechellia
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsec_GM20403
Enzymes [BR:dse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dsec_GM20403
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dsec_GM20403
  Exosomal proteins of colorectal cancer cells
   Dsec_GM20403
  Exosomal proteins of bladder cancer cells
   Dsec_GM20403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 488 aa AA seqDB search
MWRLAGVLLLGYIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEY
AKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASG
IAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYR
FGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGH
RTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHE
LNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPES
NDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAEKLQDEDVAIVKM
DATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDRS
GKPKKTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcctcgctggagtgctcctactgggctacatcgccatctcgtccggagcggag
caggatgtcctggaactgggggacgacgacttcgccaccaccctgaaacaacacgagacg
acgctagtcatgttctatgccccctggtgcggccactgcaagcgattgaagcccgagtac
gccaaggcggcggagatcgtgaaagacgatgatccgccaatcaaactggccaaggttgac
tgtacggaagctggaaaggaaacgtgtagcaagtactccgtcagcggctacccaacgctg
aagatcttccgtcaggatgaggtgtcgcaggactacaatggaccacgcgaagccagcggc
attgccaagtacatgcgcgcccaagtgggacccgcctccaagaccgtgcgcaccgttgcc
gagctgaagaagttcctggacaccaaggacaccacgctgtttggctacttcagcgacagc
gactccaagctggccaagattttcctgaagttcgccgataagaaccgcgagaagtaccgc
tttggacattccagcgaaaaggaagtcctcgataagcagggcgaaaccgacaagattgtg
cttattcgtgcgccccatttgagcaacaagttcgagtcatcttctattaagttcgagggt
agctccgagtccgatctgtctacctttgtcaaggagaacttccatggtcttgtgggacac
cgcactcaggattcggtcaaggacttccagaaccccttgatcactgcctactacagcgtg
gactaccagaagaaccccaagggaacgaactactggcgcaaccgtgtgctcaaggtggcc
aaggagtttgtgggtcaaatcaactttgcgatcgcctccaaggatgacttccagcacgag
ttgaacgagtacggctacgatttcgttggcgacaagccagtggtattggctcgcgacgaa
aagaatctcaaatacgccctgaaggacgagttctcagtggagaatctgcaggactttgtc
gagaagctgctggcgaatgagctggagccgtacattaagagtgagcctattcccgagtcg
aacgacgctcccgtcaaggtggccgtcgccaagaacttcgacgatctggttatcaacaac
ggcaaagacacgctgattgagttctacgccccatggtgcggccactgcaagaagctgact
cccatctacgaggagctggccgagaagctgcaggacgaagatgtggccatcgtcaagatg
gatgccaccgccaacgacgtgccgccggagttcaacgtgcgaggctttcccaccctcttc
tggctgcccaaggacgccaagaacaagccagtcagctacaacggaggtcgcgaggtagat
gacttccttaagtacatcgccaaggaggcgaccacagaactgaagggcttcgaccgcagc
ggcaagcccaagaagaccgagctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system